KEGG   Tetrapisispora blattae: TBLA_0B02390Help
Entry
TBLA_0B02390      CDS       T02489                                 

Gene name
TBLA0B02390
Definition
hypothetical protein
Orthology
K11482  
histone deacetylase HOS1 [EC:3.5.1.98]
Organism
tbl  Tetrapisispora blattae
Brite
Enzymes [BR:tbl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     TBLA_0B02390 (TBLA0B02390)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:558067..559806
Genome map
AA seq 579 aa AA seqDB search
MTKLIISSSKFQSAIVDLLPCNNGSKSRLTHSLIDTYGLLQYFDHVVMTPFASKDELLNF
HTIEYLNVILDEKLNKRKVEDETYIDNWNYLNQVGIEWLEENKPNESKSFELQANFQDDN
DNTIQSTNEIDQYFNSIETLYKYYSYIAKGHKATVKNYNTTSNKKRTSWEALLDELSDDS
MENSTDSANDNSSNNSSDTSSEDSNDDSGVDLNDNSSDRLSSKNATQKHEIDSYKATVIN
DIVDFDVVKLKQYNLVGDCPIFSFLPMYCHVLGGSTLRLLDHIDFNEKQICINWDGGRHH
SRKKKASGFCYVNDIVLCIQKLGEKGFRKITYLDFDLHHGDGVEKSFQYSKHIQTISVHL
FEPGFFPCTGSLEETKHGFNIVNIPTLHGLDDNYLTYLLNRVIIPLIKKHKPECLVVQCG
GDGLIGDRYKEWQMTISGLTKNIMLVLQNFPECSVVLLGGGGYNERVMSRFHTFLTWKVV
QTFSSKGSTLLDQFESDYHEEHSTKQNNDTTTMDSANTQSPFSNNMSDILIPEHEFSDFY
GEELCRFWAYELPASQYFKQLHNDNIPNYIDKLVKFYNL
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaattaattatatccagttcaaagttccaatccgctattgttgatttattacca
tgtaataacgggtccaaatcaagactaacacattctttaattgacacttatggattactg
caatactttgatcatgtcgttatgaccccatttgcttctaaagatgaattgctaaacttt
catacgattgagtatttgaatgtgatattggatgagaaattaaataaaagaaaagtagaa
gatgaaacatatattgataattggaactatttaaatcaagtgggcattgaatggctagaa
gaaaataaacccaacgagtctaaaagttttgaactgcaggcaaattttcaagatgacaat
gataacactattcaatccactaacgaaattgatcaatattttaattcaattgaaactttg
tataaatattattcatacattgcaaagggacataaagcaaccgtgaaaaattataatact
acttcaaataaaaaaaggacttcatgggaagcccttttagacgagttaagtgatgattca
atggaaaactcaacagacagtgcaaacgataattctagtaacaactcaagtgatacttca
agtgaagactcaaatgacgactcaggtgtagacttaaatgacaattcaagtgacagatta
agtagtaagaatgctactcagaaacatgaaattgattcgtataaagctactgttataaat
gatattgttgatttcgatgtagtaaaattaaaacaatataatttagttggtgattgtcca
atattttcctttttgcctatgtattgccatgtgctagggggatccacattaagattactt
gatcatattgatttcaatgaaaaacaaatctgtattaattgggatggtggtagacaccat
tcacgtaagaaaaaagctagtgggttttgctacgttaacgatatagtcttgtgtatacag
aagctaggtgagaaaggttttaggaaaattacttatctagattttgatttacatcatgga
gatggagtggagaaatcattccaatactctaaacatattcaaactatatctgttcatctg
tttgaacccggattttttccatgtactggttcgttagaagaaacaaaacatggtttcaat
attgtcaatatacctacattgcatggattagatgataactatttaacatatttattaaat
cgagtaattattcctttaataaagaaacataaaccagaatgtcttgtagtccaatgtggg
ggtgatgggttaattggtgaccgatataaagaatggcaaatgacaattagtggattgact
aaaaatatcatgctagtgttacaaaactttccagaatgttctgtagtattattaggtggt
ggtggctacaatgaacgtgtaatgagccgattccatacttttttaacttggaaagtagta
caaacattttcttcaaaaggttcgacacttttagatcaatttgaatcagactaccatgaa
gaacattctaccaagcaaaataatgataccactacaatggattctgcaaacactcaatcg
ccattctcaaataacatgtctgatattctaatcccagaacatgaattctctgatttctat
ggagaagaattgtgtcgcttttgggcgtacgaacttcctgcaagccaatatttcaaacaa
cttcacaatgacaatattccaaactacatagataagttagttaagttttacaacctttag

DBGET integrated database retrieval system