KEGG   Tetrapisispora blattae: TBLA_0B02970Help
Entry
TBLA_0B02970      CDS       T02489                                 

Gene name
TBLA0B02970
Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tbl  Tetrapisispora blattae
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TBLA_0B02970 (TBLA0B02970)
Enzymes [BR:tbl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     TBLA_0B02970 (TBLA0B02970)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:686782..687723
Genome map
AA seq 313 aa AA seqDB search
MPHRKAEKPHNILDEPLHGFYIPTALFLVGITITTYMSQEYRILYCLPVFFGIVLVRIVS
ALTRLKSITVNGWHELELMEQTLISKNSAIYRFRMKSNVDFLDFAPGQHLAVRVKIEGKE
YVRTYTPISPRHERGFFDIIVKSYPDGTVSKYFAGLVPGQTVEFQGPVGKLNYVPNSSKE
IGFIAGGSGITPLLQLVNEIVTVPEDFTKIKVIYLNETENDILLREELNEMSDKYPNFQI
AYVLHKPHQDWPGYTGYITKELMEKHLPAADDDNRLFMCGPKGMNDMALNFASELGWKVR
SQPSHPDDQVFVF
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaccgtaaagcggaaaaaccacataatattctagatgagccattacatgggttc
tatatcccaactgccttatttttagtgggtattactataactacttatatgtctcaagaa
tatagaattttgtactgtttgccagtattttttggtattgttttggtcagaatcgtctca
gcattaacaagattaaagtcaattacagttaatggctggcatgaattggaattaatggag
caaactttaatttccaagaattctgcaatctatcgtttcagaatgaaatctaatgtcgac
tttttagattttgcaccaggtcaacatcttgccgttagggttaagatcgaaggcaaagaa
tacgtcagaacgtataccccaatcagtccaagacacgaacgtggcttctttgatatcatt
gtcaaatcatatccagatggtactgtttctaaatattttgctggtttggttcccggtcaa
acagtagaattccaaggtccagttggtaaattaaattatgttccaaattcttcaaaagaa
attggattcatcgccggtggttcaggtattactccattgttacaattggttaatgaaatt
gttactgttcctgaagattttacaaaaatcaaagtcatttatttaaatgaaactgaaaac
gacattttattaagagaagagttaaatgaaatgagtgacaaatatccaaactttcaaatt
gcttatgtcttgcataaaccacatcaagattggccaggctacacaggttacatcactaag
gaactaatggaaaagcatttaccagcagctgatgatgataacagattgtttatgtgtggt
ccaaagggtatgaatgatatggcattgaactttgcttctgagttaggctggaaggttaga
tctcaaccttctcatcctgatgatcaagtatttgttttctaa

DBGET integrated database retrieval system