KEGG   Tetrapisispora blattae: TBLA_0B03480Help
Entry
TBLA_0B03480      CDS       T02489                                 

Gene name
TBLA0B03480
Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tbl  Tetrapisispora blattae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TBLA_0B03480 (TBLA0B03480)
Enzymes [BR:tbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     TBLA_0B03480 (TBLA0B03480)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(813611..814390)
Genome map
AA seq 259 aa AA seqDB search
MNGNVILLKNPRESNSKDDDYYKIFDKYGYYPNFLPVITHTNIINQIVPVLNDSDYLDEL
PFIIVTSQRALTFLNEKDLNNQYPSQNFEKLLNKPVYTVGPATAKCLRNLKFKDIRGTET
GNAEALAKLIISELDQYDLTQKPLFLTGEKHKDTITKALKTKFNISVEEIVTYKTISLDD
SLLRFKSVFKPNSWIILFSPQGTKDILKYLNDHKLNSSPFHLAAIGPYTREYLISNDLKP
DVVSPHPDPISLVNSILTF
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaaatgttattcttttaaagaacccaagagagtctaattcaaaagatgacgat
tattataaaatattcgataagtatggatattatccaaattttcttcctgtaataacacat
acaaatattatcaatcaaatcgtcccagttttaaacgattcggattatttggatgaatta
cctttcataatagttacttcacaacgggcattaacttttttaaatgaaaaagatttaaat
aatcaatatccaagtcaaaattttgaaaaattattaaataaaccagtttatactgtgggt
cctgctactgctaaatgtttgagaaacctaaaatttaaagatattagaggtactgaaacc
ggtaatgcagaagcattagccaaattaattatatctgaattagatcaatatgatcttact
caaaaaccactatttttaacaggagaaaaacataaagatactattacaaaggcattaaag
actaagttcaatatatcagtggaagaaatagttacatacaagaccatatctttggatgat
agccttttgagatttaaatctgtatttaaaccaaactcatggattatattatttagtcct
caaggaacaaaagatattttaaaatatttaaatgatcataaattaaactcatcaccattc
catcttgctgcaattggaccttatactcgtgaatatttgatttctaatgatttaaagcct
gatgtagtgagccctcatcccgatccaatttctttggtaaattcaatcttgactttttaa

DBGET integrated database retrieval system