KEGG   Tetrapisispora blattae: TBLA_0B04280Help
Entry
TBLA_0B04280      CDS       T02489                                 

Gene name
TBLA0B04280
Definition
(RefSeq) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
tbl  Tetrapisispora blattae
Pathway
tbl00220  Arginine biosynthesis
tbl00330  Arginine and proline metabolism
tbl01100  Metabolic pathways
tbl01110  Biosynthesis of secondary metabolites
tbl01130  Biosynthesis of antibiotics
tbl01230  Biosynthesis of amino acids
Module
tbl_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    TBLA_0B04280 (TBLA0B04280)
   00330 Arginine and proline metabolism
    TBLA_0B04280 (TBLA0B04280)
Enzymes [BR:tbl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     TBLA_0B04280 (TBLA0B04280)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 14494138
NCBI-ProteinID: XP_004178785
UniProt: I2GYR4
Position
2:993467..994378
Genome map
AA seq 303 aa AA seqDB search
MVLAPFSGGQLKYGVEKGPDFLLKHGLEKDLVELGWDVTITEPLKGKNLADSNDADSEFP
TVKKPTLVGETTHLINQTITDSLKDDKFILTLGGDHSIAMGSISAVLEKYDDLCLLWIDA
HADINTVESTESGNLHGCPVSFLMGVNPPDKIPKSLSWIKGNLKPNRIAYIGLRDVDEGE
KKILKENNIKAFSMYHIDRFGINKVIEMALQAINPTGKSPLMCSFDVDAIDPLYVPATGT
PVRGGLTLREGLFLTERLAETGNLVALDVVECNPDLAQNETHVLDTISAGCAIARCALGE
TLL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggtattagctccattttcgggaggtcaattgaaatatggtgtggaaaaaggtcctgat
tttctactaaagcatggcctagaaaaagatttggtcgaattaggttgggatgtcaccata
acagaaccattaaagggtaaaaatttagctgattccaacgatgctgatagtgaatttcca
actgttaaaaaaccaactttggttggtgaaactactcatttgattaatcaaactattaca
gactccttgaaggatgataaattcattttgactttaggtggtgatcattcaattgccatg
ggctccatttctgcagttttggaaaaatatgatgacttatgtcttttatggattgatgct
catgcagatatcaatactgttgaatcaacagagtcagggaacttgcacggttgtccagtt
tcattcttaatgggggtaaatccaccagataaaatcccaaagtcattgagttggatcaaa
ggtaatttaaaaccaaatagaatcgcatacatcggtttaagagatgttgatgaaggtgaa
aaaaaaatcttgaaggaaaataatattaaagccttttcgatgtaccatattgatagattt
gggattaataaagtaattgaaatggcattgcaagccattaatccaactggtaaatctcca
ctcatgtgttcttttgatgttgatgcaattgatccattatacgtgccagctactggcact
cctgtaagaggaggccttactttaagagagggtctgttcttgactgaaagattagctgaa
actggaaatttagtagctttagatgttgtagaatgcaatccagatttggctcaaaatgaa
actcatgttctagatactatttcagctggctgtgctattgcaagatgtgccttaggtgaa
acattactgtaa

DBGET integrated database retrieval system