KEGG   Tetrapisispora blattae: TBLA_0B04280Help
Entry
TBLA_0B04280      CDS       T02489                                 

Gene name
TBLA0B04280
Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
tbl  Tetrapisispora blattae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TBLA_0B04280 (TBLA0B04280)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TBLA_0B04280 (TBLA0B04280)
Enzymes [BR:tbl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     TBLA_0B04280 (TBLA0B04280)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:993467..994378
Genome map
AA seq 303 aa AA seqDB search
MVLAPFSGGQLKYGVEKGPDFLLKHGLEKDLVELGWDVTITEPLKGKNLADSNDADSEFP
TVKKPTLVGETTHLINQTITDSLKDDKFILTLGGDHSIAMGSISAVLEKYDDLCLLWIDA
HADINTVESTESGNLHGCPVSFLMGVNPPDKIPKSLSWIKGNLKPNRIAYIGLRDVDEGE
KKILKENNIKAFSMYHIDRFGINKVIEMALQAINPTGKSPLMCSFDVDAIDPLYVPATGT
PVRGGLTLREGLFLTERLAETGNLVALDVVECNPDLAQNETHVLDTISAGCAIARCALGE
TLL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggtattagctccattttcgggaggtcaattgaaatatggtgtggaaaaaggtcctgat
tttctactaaagcatggcctagaaaaagatttggtcgaattaggttgggatgtcaccata
acagaaccattaaagggtaaaaatttagctgattccaacgatgctgatagtgaatttcca
actgttaaaaaaccaactttggttggtgaaactactcatttgattaatcaaactattaca
gactccttgaaggatgataaattcattttgactttaggtggtgatcattcaattgccatg
ggctccatttctgcagttttggaaaaatatgatgacttatgtcttttatggattgatgct
catgcagatatcaatactgttgaatcaacagagtcagggaacttgcacggttgtccagtt
tcattcttaatgggggtaaatccaccagataaaatcccaaagtcattgagttggatcaaa
ggtaatttaaaaccaaatagaatcgcatacatcggtttaagagatgttgatgaaggtgaa
aaaaaaatcttgaaggaaaataatattaaagccttttcgatgtaccatattgatagattt
gggattaataaagtaattgaaatggcattgcaagccattaatccaactggtaaatctcca
ctcatgtgttcttttgatgttgatgcaattgatccattatacgtgccagctactggcact
cctgtaagaggaggccttactttaagagagggtctgttcttgactgaaagattagctgaa
actggaaatttagtagctttagatgttgtagaatgcaatccagatttggctcaaaatgaa
actcatgttctagatactatttcagctggctgtgctattgcaagatgtgccttaggtgaa
acattactgtaa

DBGET integrated database retrieval system