KEGG   Tetrapisispora blattae: TBLA_0B04520Help
Entry
TBLA_0B04520      CDS       T02489                                 

Gene name
TBLA0B04520
Definition
(RefSeq) hypothetical protein
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
tbl  Tetrapisispora blattae
Brite
Enzymes [BR:tbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TBLA_0B04520 (TBLA0B04520)
Transfer RNA biogenesis [BR:tbl03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    TBLA_0B04520 (TBLA0B04520)
Chromosome [BR:tbl03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    TBLA_0B04520 (TBLA0B04520)
   HAT complexes
    Elongator complex
     TBLA_0B04520 (TBLA0B04520)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Motif
Other DBs
NCBI-GeneID: 14494581
NCBI-ProteinID: XP_004178807
UniProt: I2GYT6
Position
2:1040195..1041877
Genome map
AA seq 560 aa AA seqDB search
MGRKGKGPKTNKQKLLPEKERFIECCSDISLELTNSLTSSNTREINLNGLITKYSKKYKL
KQQPRLTDVINSIPDQYKKYLLPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVY
CPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRIEQLKQLGHSVDKVEYIIMG
GTFMSLPKDYREDFITNLHNALSGFNGNDLDEAIQYSQQSLTKCVGITIETRPDYCTKPH
LDDMLRYGCTRLEIGVQSLYEDVARDTNRGHTVKSVSEIFALSKDAGYKVVSHMMPDLPN
VGMERDLEQFKEYFENPNFRTDGLKIYPTLVIRGTGLYELWKVGKYKSYNANALIDLVAR
IMALVPPWTRIYRVQRDIPMPLVTSGVDNGNLRELALARMKDFGTKCRDIRTREVGIQEV
HHKIQPDQVELIRRDYYANGGWETFLSYEDPKKDILIGLVRLRKASKKYTYRKEFINQRT
SIVRELHVYGSVVPLHSRDPRKFQHQGFGTLLMEEAERIAREEHGSEKISVISGVGVRNY
YAKLGYELDGPYMSKKISAY
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgggtagaaaaggtaaaggtcctaaaacaaacaaacaaaaattattgccagaaaaagaa
cgttttattgaatgttgttctgatatttctttagaattaacaaattctttaacttcatcc
aatacaagagaaattaatttaaatggattaattactaaatattccaaaaaatataaatta
aaacaacaaccaagattaacagatgttattaattccattcccgatcaatataaaaaatat
ttattaccaaaattaaaggctaaaccggttagaactgcctcaggtattgctgtagtagca
gtcatgtgtaaacctcatcgttgtcctcatattgcatacacaggtaatatttgtgtttat
tgtccaggtggtccagattcagatttcgaatattctactcaatcttatacaggatatgaa
ccaacgtcaatgagagccattagagctcgttatgatccatatgaacaagctcgtggtaga
attgaacaattaaaacaattgggtcattctgtggataaagtagaatatattattatgggt
ggtacattcatgtccttgccaaaagattatcgtgaagatttcattactaatttacataat
gcattatctgggtttaatggtaatgatttggatgaagctattcaatattctcaacaaagt
ttaactaaatgtgttggtattaccattgaaacaagaccagattattgtacaaagccacat
ttggatgatatgttaagatatggttgtacaagattagagattggtgttcaatcattatat
gaagatgtggctcgtgatactaatagaggtcataccgttaaatctgtatctgaaattttt
gcattatcaaaggatgctggttataaagttgtgtcacatatgatgcccgatttaccaaat
gtaggtatggaaagagatcttgaacaatttaaagaatattttgaaaaccctaattttaga
actgatgggttaaagatttatccaactttagtcattaggggtacaggtttatatgaatta
tggaaagttggtaaatataaatcttataatgctaacgcattaatcgatttagtcgcaaga
atcatggcattagtaccaccatggactagaatttatagagttcaaagagatattccaatg
cccttagttacctctggtgttgataatggtaatttaagagaacttgcattggctagaatg
aaagattttggtacaaaatgtagagatatccgtacaagagaagttggtatccaagaggtc
catcataagattcaacctgatcaagtagaattgattagaagagactattatgctaatggg
ggttgggaaacattcctttcatatgaagatccaaagaaagatattttgattggtttagtt
agattaagaaaggcatctaaaaaatatacatatagaaaggaatttataaatcaaaggacc
tctatcgtgagagaattacatgtttatggttctgttgtacctttacattcaagagatcct
cgtaagttccaacatcaaggtttcggtactctattgatggaagaagcagaaagaattgct
cgtgaagaacacggttctgaaaaaatctctgttatttctggtgttggtgttagaaactat
tatgccaagttagggtatgaattggatgggccatatatgtctaaaaagatatctgcatat
taa

DBGET integrated database retrieval system