KEGG   Tetrapisispora blattae: TBLA_0B04520Help
Entry
TBLA_0B04520      CDS       T02489                                 

Gene name
TBLA0B04520
Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
tbl  Tetrapisispora blattae
Brite
Enzymes [BR:tbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TBLA_0B04520 (TBLA0B04520)
Transfer RNA biogenesis [BR:tbl03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    TBLA_0B04520 (TBLA0B04520)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1040195..1041877
Genome map
AA seq 560 aa AA seqDB search
MGRKGKGPKTNKQKLLPEKERFIECCSDISLELTNSLTSSNTREINLNGLITKYSKKYKL
KQQPRLTDVINSIPDQYKKYLLPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVY
CPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRIEQLKQLGHSVDKVEYIIMG
GTFMSLPKDYREDFITNLHNALSGFNGNDLDEAIQYSQQSLTKCVGITIETRPDYCTKPH
LDDMLRYGCTRLEIGVQSLYEDVARDTNRGHTVKSVSEIFALSKDAGYKVVSHMMPDLPN
VGMERDLEQFKEYFENPNFRTDGLKIYPTLVIRGTGLYELWKVGKYKSYNANALIDLVAR
IMALVPPWTRIYRVQRDIPMPLVTSGVDNGNLRELALARMKDFGTKCRDIRTREVGIQEV
HHKIQPDQVELIRRDYYANGGWETFLSYEDPKKDILIGLVRLRKASKKYTYRKEFINQRT
SIVRELHVYGSVVPLHSRDPRKFQHQGFGTLLMEEAERIAREEHGSEKISVISGVGVRNY
YAKLGYELDGPYMSKKISAY
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgggtagaaaaggtaaaggtcctaaaacaaacaaacaaaaattattgccagaaaaagaa
cgttttattgaatgttgttctgatatttctttagaattaacaaattctttaacttcatcc
aatacaagagaaattaatttaaatggattaattactaaatattccaaaaaatataaatta
aaacaacaaccaagattaacagatgttattaattccattcccgatcaatataaaaaatat
ttattaccaaaattaaaggctaaaccggttagaactgcctcaggtattgctgtagtagca
gtcatgtgtaaacctcatcgttgtcctcatattgcatacacaggtaatatttgtgtttat
tgtccaggtggtccagattcagatttcgaatattctactcaatcttatacaggatatgaa
ccaacgtcaatgagagccattagagctcgttatgatccatatgaacaagctcgtggtaga
attgaacaattaaaacaattgggtcattctgtggataaagtagaatatattattatgggt
ggtacattcatgtccttgccaaaagattatcgtgaagatttcattactaatttacataat
gcattatctgggtttaatggtaatgatttggatgaagctattcaatattctcaacaaagt
ttaactaaatgtgttggtattaccattgaaacaagaccagattattgtacaaagccacat
ttggatgatatgttaagatatggttgtacaagattagagattggtgttcaatcattatat
gaagatgtggctcgtgatactaatagaggtcataccgttaaatctgtatctgaaattttt
gcattatcaaaggatgctggttataaagttgtgtcacatatgatgcccgatttaccaaat
gtaggtatggaaagagatcttgaacaatttaaagaatattttgaaaaccctaattttaga
actgatgggttaaagatttatccaactttagtcattaggggtacaggtttatatgaatta
tggaaagttggtaaatataaatcttataatgctaacgcattaatcgatttagtcgcaaga
atcatggcattagtaccaccatggactagaatttatagagttcaaagagatattccaatg
cccttagttacctctggtgttgataatggtaatttaagagaacttgcattggctagaatg
aaagattttggtacaaaatgtagagatatccgtacaagagaagttggtatccaagaggtc
catcataagattcaacctgatcaagtagaattgattagaagagactattatgctaatggg
ggttgggaaacattcctttcatatgaagatccaaagaaagatattttgattggtttagtt
agattaagaaaggcatctaaaaaatatacatatagaaaggaatttataaatcaaaggacc
tctatcgtgagagaattacatgtttatggttctgttgtacctttacattcaagagatcct
cgtaagttccaacatcaaggtttcggtactctattgatggaagaagcagaaagaattgct
cgtgaagaacacggttctgaaaaaatctctgttatttctggtgttggtgttagaaactat
tatgccaagttagggtatgaattggatgggccatatatgtctaaaaagatatctgcatat
taa

DBGET integrated database retrieval system