KEGG   Tetrapisispora blattae: TBLA_0B04840Help
Entry
TBLA_0B04840      CDS       T02489                                 

Gene name
TBLA0B04840
Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
tbl  Tetrapisispora blattae
Brite
Enzymes [BR:tbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TBLA_0B04840 (TBLA0B04840)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1141845..1143017)
Genome map
AA seq 390 aa AA seqDB search
MTLSDFKPETWTTSSIEALKISLVGENAIQFPPNFTHAIFGETEQIFGYKDLIIHLVFDS
VTFKPFFNIKYSKKLDNDEIDDIKAKLLNYLPKEDVVFKDEEKWIDQFEHEQKTFELPDD
SFKINEYSADDGDFIIFKQNVNVPFCEKLHRRIQILSLFFIDGASYIDANDSNWEIFWLF
DKNSKKCIGFSTTYKYWTYINAEEFNKENNLKYRAKISQFLILPPYQNKGHGTKFYESIV
DFWMKESSIIEITVEDPNESFDDLRDRCDLNRLYEKGFFQEVTSVKEFDEKWYSNNKSKF
KLETRQFKRLVEMILLYKESSLFPQQVKIRLYQKNCDALKAMEEEDQIEALDKQFNLLKE
DYTRILMQCKFLKRKIKLEDSTPSLKKKRV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgacattatctgattttaagccagaaacctggacaacttcatctattgaagccttgaag
atatcattagttggagaaaatgctatccaattcccacctaattttactcatgctatcttt
ggtgaaacagaacaaatatttggttataaagatttaattattcatttagtatttgattct
gtcacctttaagcctttcttcaacattaaatattccaaaaaattggataatgatgaaatt
gatgatattaaagcaaaattattaaattatttaccaaaggaagatgttgtctttaaagat
gaagaaaaatggatagatcaatttgaacatgaacagaaaacttttgaattacctgatgat
agttttaagatcaatgaatattctgcagatgatggtgattttataattttcaaacaaaac
gtcaatgtcccattctgtgaaaaattacatagaagaattcaaatcttatccttatttttt
attgatggtgcatcatatatagacgcaaatgattcaaattgggaaatattttggttattt
gataaaaattcgaaaaaatgtattggattctctacaacatataaatattggacatatatt
aacgctgaagaatttaataaagaaaataatttaaaatacagagctaaaatttctcaattt
ttaatcctacctccatatcagaataaaggtcatggtaccaagttttatgaatccatcgta
gatttctggatgaaagaatcatccattattgaaataactgttgaagatccaaatgaaagt
tttgatgatctaagagatcgttgtgacttaaatcggttatatgaaaagggatttttccaa
gaagtcacttcagtgaaagaattcgatgaaaaatggtactcgaataataaatcaaaattt
aaattagaaactagacaatttaaacgattagtggaaatgattctgctttataaagaatcc
tcactcttcccgcaacaagtgaaaataagattatatcagaagaattgtgacgccttaaaa
gcaatggaagaagaagatcaaatagaggctttagacaaacaatttaatctcttgaaagag
gattacacacgcattttaatgcaatgtaaatttttgaaaagaaaaatcaaattggaagat
tccactccatctttaaagaaaaagagagtttga

DBGET integrated database retrieval system