KEGG   Tetrapisispora blattae: TBLA_0C00500Help
Entry
TBLA_0C00500      CDS       T02489                                 

Gene name
TBLA0C00500
Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
tbl  Tetrapisispora blattae
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:tbl01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:tbl00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(91965..93689)
Genome map
AA seq 574 aa AA seqDB search
MSSKLLNSKLYINSKALTKTLKNKRFIHDNGSPYIDSKEDIASIEKWWSSPRYMDLKRDH
TSLDIVKHRGNLSLQNYTKYPSSFQADKLFNLVNSHFNEKKPLHTLGVIDPLQMSQLAKC
KEIKVSYISGWACSSTLVGSTNEVSPDFGDYPYDTVPNQVERIFKAQQLHDRKYMLSNFN
SSGSKKEEVDYLKPIIADADMGHGGLTSVMKMAKLFAEKGAAGIHLEDQLMGGKKCGHLG
GSVVVPTATHLSRLKATRFQWDLMGTNNLIIARTDSLNSRLLSSCVDPRDHAFIKGIINK
NEKPLSDTIIDTQSAIDISKDDFAAIEENWYDKNKLYTYDEAVELQLSNEEFNQYKSLKA
KLTNTKMDKNYFSIYEMREITRQVAPNKTVHFDWDAPKTIEGHYMFNGCTEAAIQRSIAF
APYADLIWLETKTPDLNEATNFARKIHSVYPNTKLVYNLSPSFNWMENGFTPDTLKSFIW
DLAKEGFVLQLVSLAGLHVDGVSFWELAKDFQYNGMKSYVDIVQRKEKEINCDILTHQKW
SGAEYIDSIMNVVNNGSSSKTQSTTGSSYTESQF
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctaaattattaaattccaaactttatattaattcaaaagctttgacaaagact
ttaaaaaataaacgatttattcacgacaatggatcaccatatattgattccaaagaggat
attgcttccatcgaaaaatggtggagttcaccaagatatatggacttgaaaagagaccat
acttctttagatattgtaaagcatagaggtaatttatctttacaaaattataccaaatac
ccttcatctttccaagctgataaattatttaatttagttaattcacatttcaatgagaaa
aaaccattacatacactgggggttattgatccactccaaatgtcacaacttgctaaatgc
aaagaaattaaagttagttatatatcaggatgggcctgttcttccacattagttgggtcc
acaaatgaagtatctccagattttggtgattacccttatgatactgtaccaaatcaggta
gaaagaatctttaaagctcaacagttacatgataggaaatatatgttgtccaactttaat
tccagtgggagcaagaaggaagaagtcgattatttgaaaccaattattgctgatgccgat
atgggtcatggtggattaacttcagtaatgaaaatggctaagttatttgcagaaaaggga
gcagctggcatacatctggaagatcaattaatgggtggtaaaaaatgtggccatttaggt
gggtccgtagtagttcctactgcaacacatctttctcggttaaaagctactagatttcaa
tgggatctaatggggacaaacaacttgattattgcaagaacagactcattaaatagtagg
ctactaagtagttgtgtggacccaagagaccatgcctttattaaaggtataatcaataag
aatgaaaaaccattatcagacacaattattgatactcaatctgctattgatataagtaaa
gacgatttcgcagcaatagaagaaaattggtacgataaaaataaattatatacatatgat
gaagctgttgaattacaattatcaaatgaagagtttaatcaatataaaagtttgaaagca
aaattaaccaataccaaaatggacaaaaattactttagtatttatgaaatgagagaaata
acaagacaagtggcccccaataaaactgttcatttcgattgggatgctccaaagacaata
gaaggccattatatgttcaacgggtgtacagaagctgccattcaaagatccatcgcattt
gccccatatgctgatttgatttggctggagacaaagacaccagatttaaatgaagccaca
aattttgcaagaaaaattcactctgtatatccaaacactaaattggtttataatttatcc
ccaagttttaactggatggaaaacgggtttacacccgatacattaaaaagcttcatttgg
gatcttgcaaaagaaggttttgtattacaattagtatccttggctgggttacatgtggat
ggagtttctttctgggaattagccaaggacttccaatacaatggtatgaaatcttacgta
gacatagtccaaaggaaggaaaaagaaataaattgtgacattttaactcatcaaaaatgg
tcaggagctgaatatatagactcaattatgaatgttgtaaataacggttcatcatcgaaa
acccaaagtactacgggttcttcttatacagaatcccaattctaa

DBGET integrated database retrieval system