KEGG   Tetrapisispora blattae: TBLA_0C00500Help
Entry
TBLA_0C00500      CDS       T02489                                 

Gene name
TBLA0C00500
Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
tbl  Tetrapisispora blattae
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TBLA_0C00500 (TBLA0C00500)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TBLA_0C00500 (TBLA0C00500)
Enzymes [BR:tbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     TBLA_0C00500 (TBLA0C00500)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(91965..93689)
Genome map
AA seq 574 aa AA seqDB search
MSSKLLNSKLYINSKALTKTLKNKRFIHDNGSPYIDSKEDIASIEKWWSSPRYMDLKRDH
TSLDIVKHRGNLSLQNYTKYPSSFQADKLFNLVNSHFNEKKPLHTLGVIDPLQMSQLAKC
KEIKVSYISGWACSSTLVGSTNEVSPDFGDYPYDTVPNQVERIFKAQQLHDRKYMLSNFN
SSGSKKEEVDYLKPIIADADMGHGGLTSVMKMAKLFAEKGAAGIHLEDQLMGGKKCGHLG
GSVVVPTATHLSRLKATRFQWDLMGTNNLIIARTDSLNSRLLSSCVDPRDHAFIKGIINK
NEKPLSDTIIDTQSAIDISKDDFAAIEENWYDKNKLYTYDEAVELQLSNEEFNQYKSLKA
KLTNTKMDKNYFSIYEMREITRQVAPNKTVHFDWDAPKTIEGHYMFNGCTEAAIQRSIAF
APYADLIWLETKTPDLNEATNFARKIHSVYPNTKLVYNLSPSFNWMENGFTPDTLKSFIW
DLAKEGFVLQLVSLAGLHVDGVSFWELAKDFQYNGMKSYVDIVQRKEKEINCDILTHQKW
SGAEYIDSIMNVVNNGSSSKTQSTTGSSYTESQF
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctaaattattaaattccaaactttatattaattcaaaagctttgacaaagact
ttaaaaaataaacgatttattcacgacaatggatcaccatatattgattccaaagaggat
attgcttccatcgaaaaatggtggagttcaccaagatatatggacttgaaaagagaccat
acttctttagatattgtaaagcatagaggtaatttatctttacaaaattataccaaatac
ccttcatctttccaagctgataaattatttaatttagttaattcacatttcaatgagaaa
aaaccattacatacactgggggttattgatccactccaaatgtcacaacttgctaaatgc
aaagaaattaaagttagttatatatcaggatgggcctgttcttccacattagttgggtcc
acaaatgaagtatctccagattttggtgattacccttatgatactgtaccaaatcaggta
gaaagaatctttaaagctcaacagttacatgataggaaatatatgttgtccaactttaat
tccagtgggagcaagaaggaagaagtcgattatttgaaaccaattattgctgatgccgat
atgggtcatggtggattaacttcagtaatgaaaatggctaagttatttgcagaaaaggga
gcagctggcatacatctggaagatcaattaatgggtggtaaaaaatgtggccatttaggt
gggtccgtagtagttcctactgcaacacatctttctcggttaaaagctactagatttcaa
tgggatctaatggggacaaacaacttgattattgcaagaacagactcattaaatagtagg
ctactaagtagttgtgtggacccaagagaccatgcctttattaaaggtataatcaataag
aatgaaaaaccattatcagacacaattattgatactcaatctgctattgatataagtaaa
gacgatttcgcagcaatagaagaaaattggtacgataaaaataaattatatacatatgat
gaagctgttgaattacaattatcaaatgaagagtttaatcaatataaaagtttgaaagca
aaattaaccaataccaaaatggacaaaaattactttagtatttatgaaatgagagaaata
acaagacaagtggcccccaataaaactgttcatttcgattgggatgctccaaagacaata
gaaggccattatatgttcaacgggtgtacagaagctgccattcaaagatccatcgcattt
gccccatatgctgatttgatttggctggagacaaagacaccagatttaaatgaagccaca
aattttgcaagaaaaattcactctgtatatccaaacactaaattggtttataatttatcc
ccaagttttaactggatggaaaacgggtttacacccgatacattaaaaagcttcatttgg
gatcttgcaaaagaaggttttgtattacaattagtatccttggctgggttacatgtggat
ggagtttctttctgggaattagccaaggacttccaatacaatggtatgaaatcttacgta
gacatagtccaaaggaaggaaaaagaaataaattgtgacattttaactcatcaaaaatgg
tcaggagctgaatatatagactcaattatgaatgttgtaaataacggttcatcatcgaaa
acccaaagtactacgggttcttcttatacagaatcccaattctaa

DBGET integrated database retrieval system