KEGG   Tetrapisispora blattae: TBLA_0C01380Help
Entry
TBLA_0C01380      CDS       T02489                                 

Gene name
TBLA0C01380
Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tbl  Tetrapisispora blattae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TBLA_0C01380 (TBLA0C01380)
Enzymes [BR:tbl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     TBLA_0C01380 (TBLA0C01380)
Exosome [BR:tbl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TBLA_0C01380 (TBLA0C01380)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:313840..315951
Genome map
AA seq 703 aa AA seqDB search
MTDIPENVKGVIEFDPWLKPWAQVLSERRYLADQWVYDITHATPDHSHQSLAQFARDSYN
SYGLHADHNTKKIHYKEWAPNAKKAFLIGEFNNWNESSHEMTHKDEFGNFYITLEPTHDG
KFQIPHDSKIKVMFELQDGSKIYRIPAWITRTTQPSKETKEQYGPTYEGRFWNPEQTYQF
KHQRPKFNRANDSLRIYEAHIGISSPEPKIATYKEFTQNLLPRIKYLGYDAIQLMAIMEH
AYYASFGYQVTNFFAISSRYGTPEDLKELIDTAHSMGILVLLDVVHSHASKNVEDGLNRF
DGSDHQYFHSLASGRGEHPLWDSRLFNYGHFEVQRFLLSNLAFYIDVYQFDGFRFDGVTS
MLYLHHGTGEGGAFSGDYNEYLSKERSAVDHEALAYLMIANNLVHEMLPESGITIAEDVS
GYPTLSMPREMGGGGFDYRLAMALPDMWIKLLKEKKDEDWDIGHIVHTLTNRRHGEKVVA
YCESHDQALVGDKTLAFWLMDAAMYTDMTVLKETTQTIDRGIALHKVIRLLTHSLGGEAY
LNFEGNEFGHPEWLDFPNANNNDSYHYARRQFNLVDDHLLRYKYLYEFDRALQLAEKHHQ
WLNTPQAYVSLKHEVDKIIAFERNGLLFIFNLHPTESFADYRIGVEQAGTYKIILNTDRE
EFGGHARIDEGSRFHTTDLAWNNRRNFLQVYIPNRTAIVLALE
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgactgatattcctgagaacgtcaaaggtgttattgaattcgacccctggttaaaacct
tgggcccaagtcctttctgaaagaaggtatttggcagatcaatgggtttacgacattact
catgcgactcctgatcattcacatcaatctttggcccaatttgctagagattcttacaat
tcctatggtttacatgctgatcataataccaagaagatccattacaaggaatgggctcct
aatgccaagaaagcttttttaattggggaattcaacaattggaacgaatcatctcatgaa
atgacacataaggatgaatttgggaacttttacatcacattagaacctacacacgatggg
aaattccaaatccctcacgattccaagattaaggtcatgtttgagttacaggacggctcc
aagatctatagaatccctgcttggatcactagaactactcaaccttccaaggaaaccaaa
gaacaatacggtccaacatacgaaggtagattctggaaccctgaacaaacttatcaattt
aaacatcaaagaccaaaattcaaccgtgccaacgattctttaagaatttatgaagctcat
attggtatttcttctccagaaccaaagattgctacttacaaagaattcacacaaaattta
ttaccaagaatcaaatatttaggttatgatgctattcaattgatggctattatggaacat
gcttattatgcttcctttggttatcaagttactaattttttcgctatttcatctcgttac
ggtactccagaagatttgaaagaattgatcgatactgctcattcaatgggtattttggtt
ttattagatgtggttcattcacatgcttccaagaacgtagaagatgggttaaatagattc
gatggttctgatcatcaatatttccattctttagcttccggtagaggtgaacatccatta
tgggactctagattattcaattatggccatttcgaagtccaaagatttttattatccaat
ttagcattctacatcgatgtgtatcaatttgatgggtttagattcgatggtgttacttca
atgttatacttgcatcatggtactggtgaaggtggtgcatttagtggtgattataatgaa
tatctttctaaagaacgttctgctgtagatcatgaagctttggcttatttaatgattgcc
aacaatttggttcatgaaatgttacctgaatcaggtattaccattgcagaagatgtttct
gggtacccaactttatctatgccacgtgaaatgggtggtggtggtttcgattacagattg
gccatggctttaccagatatgtggattaaattgttgaaagaaaagaaggatgaagactgg
gatataggtcacattgttcacactttaaccaatagaagacatggtgaaaaagttgttgcc
tattgtgaatctcatgatcaagctttagtaggcgataagactttagcattttggttaatg
gacgctgctatgtatactgatatgactgttttgaaagaaaccactcaaacaattgatcgt
ggtattgctcttcataaagttattagattattaacacattcacttggtggtgaagcttat
ttgaatttcgaaggtaatgaattcggtcatccagaatggttagatttcccaaatgccaat
aataacgacagttatcattatgctcgtagacaattcaatttagtagatgaccatttatta
cgttacaaatatctatatgaatttgatcgtgctttacaactagcagaaaaacaccatcag
tggttgaacactccacaagcttatgtctctttgaaacatgaggtcgacaaaatcattgcc
tttgaaagaaacggcttgttattcatcttcaacctccatccaaccgaatctttcgccgac
tatagaattggtgttgaacaagcaggtacttacaagattatcttgaacactgatagagag
gaattcggtggccatgcaagaatcgatgaagggtcaagattccataccaccgacttggct
tggaacaacagaagaaatttccttcaagtatacatcccaaacagaacagctatcgttctc
gctttggaatga

DBGET integrated database retrieval system