KEGG   Tetrapisispora blattae: TBLA_0C04660Help
Entry
TBLA_0C04660      CDS       T02489                                 

Gene name
TBLA0C04660
Definition
(RefSeq) hypothetical protein
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
tbl  Tetrapisispora blattae
Pathway
tbl00630  Glyoxylate and dicarboxylate metabolism
tbl01100  Metabolic pathways
tbl01110  Biosynthesis of secondary metabolites
tbl01200  Carbon metabolism
Module
tbl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TBLA_0C04660 (TBLA0C04660)
Enzymes [BR:tbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     TBLA_0C04660 (TBLA0C04660)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 14495242
NCBI-ProteinID: XP_004179781
UniProt: I2H1L0
Position
3:complement(1134013..1135779)
Genome map
AA seq 588 aa AA seqDB search
MPVATNQTKPKESVTSHEDVIAKIKQTNAAAAASKTDTSLNEFEKLQNSLLEESKRIEKW
WQEPRWKGIQRPYSAMDIAKKRGNFPETIKYPSSVMSEKLFKTLEKHFEDKTVSMTFGAM
DPVQITQMAKYLDTIYVSGWQCSSTASTSNEPGPDLADYPMDTVPNKVEHLFKAQQFHNR
RQYEERSNATSLEELEKMGPEIDYLTPIVADADAGHGGLTAVFKLTKMFIERGAAGIHME
DQTSTNKKCGHMSGRCVIPVQEHINRLVTIRMCSDIMNSSLIIVARTDSEEATLLSSTID
KRDHYFIIGATNEKILEDEGTFVEFMDECIANKDDLQAKETYWNDKAGLKLFNEAFADAV
EKDDNIKDKQNIIDEFNAKVGPYDGKSIYEMQAICKQLIGHTIFFDWDICRVREGLYRYK
GGTKCSIMRAREFSKYADLVWMESNLPDYEQAREFAEGIHDLNPNKWMAYNLSPSFNWNK
AMSIDDQETFIKRLGLLGYNWQFITLAGLHTTALAIDQFSKNFIKHGMKSYAQDIQQQEI
AQGVDIVKHQKWSGAEYIDGILRLAQGGVSATAAMGQGVTETQFQAER
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttgctacgaatcaaaccaaaccaaaagaatctgttacttcacatgaagatgtg
attgccaagatcaaacaaacaaatgctgctgctgctgcctccaagactgatacctctctt
aatgaatttgaaaaattacaaaactcattattagaagaaagtaaacgtattgaaaaatgg
tggcaggaaccaagatggaaggggatccaacgtccatattctgccatggatattgccaaa
aaacgtggtaattttcctgaaacgattaaatacccatcatctgtcatgtcagaaaaatta
ttcaagactcttgaaaaacatttcgaagacaagactgtttcaatgacatttggtgctatg
gatccagtacaaatcactcaaatggccaaatatttggatactatctatgtttctggttgg
caatgttcctctacagcttctacttctaatgaacctggtcctgatttggctgattacccc
atggatactgtccccaataaagtggaacatttatttaaagcccaacaattccataatcgt
agacaatatgaagaaagaagtaatgctactagtttagaagaattggaaaagatgggtcct
gagatcgattatttgacccctattgtagctgatgcagatgctggtcatggtggattaact
gcagtctttaaattaaccaaaatgtttattgaaagaggtgctgctggtattcatatggaa
gatcaaactagtactaataagaagtgtggtcacatgtctggtagatgtgttatcccagta
caagaacatatcaatcgtttggttaccattagaatgtgttctgatatcatgaatagttca
ttgatcattgtggcaagaactgattcggaagaagctacattgttaagttctactattgac
aagagagatcattatttcatcattggtgctaccaatgaaaaaatcttggaagatgaaggt
acttttgttgaatttatggatgaatgtattgctaacaaggatgatttacaagccaaagaa
acttattggaatgataaagccggtttgaaattattcaatgaagcctttgctgatgctgtt
gagaaagatgataatatcaaagataaacaaaacatcattgatgaattcaatgccaaagta
gggccatatgatggtaaatcaatttatgagatgcaagctatttgtaaacaattgattggt
cacacgattttctttgattgggatatctgcagggtccgtgaagggttataccgttacaaa
ggtggtaccaaatgttctataatgagagctcgtgaattctccaaatacgctgatttagta
tggatggaaagtaacttgcctgattatgaacaagctcgtgaatttgccgaagggatccac
gatttgaaccctaacaaatggatggcatataacttatccccaagtttcaattggaataaa
gccatgagcatcgacgatcaagaaactttcatcaaaagactcggtttattggggtacaac
tggcaatttattacattggcaggcttacataccactgctttggccattgaccaattttcc
aagaatttcatcaagcatggtatgaagagttatgcacaagacatccaacaacaggagatt
gcccagggcgttgacattgtcaaacatcaaaaatggtctggggcagagtatatcgacggt
atcttgaggcttgctcaaggtggtgtcagcgccacagcagccatgggccaaggtgtcacc
gagactcaattccaagccgagaggtag

DBGET integrated database retrieval system