KEGG   Tetrapisispora blattae: TBLA_0C06220Help
Entry
TBLA_0C06220      CDS       T02489                                 

Gene name
TBLA0C06220
Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tbl  Tetrapisispora blattae
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    TBLA_0C06220 (TBLA0C06220)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    TBLA_0C06220 (TBLA0C06220)
Enzymes [BR:tbl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     TBLA_0C06220 (TBLA0C06220)
Lipid biosynthesis proteins [BR:tbl01004]
 Desaturase
  First
   TBLA_0C06220 (TBLA0C06220)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:1507690..1509174
Genome map
AA seq 494 aa AA seqDB search
MLDDSSTKTESFSKRSTPEVGAGVQQKKIPSVNTEQANFVAAGLDKKTARVVNGLGSLMG
TKKMVDVQNSNSKVDIHISEQPWTLNNWYLKLNWLNFVLVVLIPAAGFYVAFKQWIPIKR
ETVLFALFYYVYAGITITAGYHRLWAHRAYSARWPLRLFFAFFGSANVEGSIKWWGHSHR
IHHRYTDTNKDPYDARKGLWYSHMGWMLVKPNPKYKARADISDLLEDPIVVFQHKHYIPL
MFLSGFILPCLVCGYFFDDYKGGFLYAGIIRIFLIQQATFCINSLAHYLGAQPFDNRRTP
RDNWITALVTFGEGYHNFHHEFPSDYRNAIKWYQYDPTKIFIFVSYIFGLSYNLQKFSNN
AIQIGIIQQKIKQINKDKAALNWGPRLIDLPIWKVQDFVDNLETNPNLIVVSGIVHDITN
YIDRHPGGQKLIKEARGKDATSVFNGGVYNHSNAANNVLATMRVAMLEDNLPQAFKFAKR
RGEVYDEGKFMKNL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgattcctctacaaagacagaatccttttcaaaaagatccactccagaagtt
ggtgctggagtgcaacaaaaaaagattccttcagttaatactgagcaagccaattttgtg
gctgctggtttggacaagaagactgcccgtgtggtgaacgggttagggtcgttgatgggg
accaagaagatggtggatgtgcaaaattccaacagcaaggtcgatattcatatttctgaa
caaccttggactttgaacaattggtatttgaaattgaactggttgaattttgttcttgtg
gttttaattcctgctgctgggttctacgtggcttttaagcaatggattcctatcaagaga
gagactgtcttgtttgccttgttctattatgtgtatgccggtattaccattactgcgggt
tatcacagattatgggctcatcgtgcttattcggctcgttggccattgcgtttatttttc
gcctttttcgggtctgctaacgtagaagggtctattaaatggtggggccattctcacaga
attcatcaccgttatactgataccaataaggatccatatgacgctagaaaagggttatgg
tattcacacatgggttggatgttggtgaagccaaatccaaaatacaaggctagagccgat
atcagtgatttattagaagatccaattgttgttttccaacacaagcattatatcccattg
atgtttctttccgggtttattttgccatgtttggtgtgtggttattttttcgatgattac
aaaggtggtttcttgtacgcaggcattatccgtatctttttaattcaacaagctaccttc
tgtatcaattctttggctcattatttgggtgctcaaccgtttgacaatagaagaactcca
agagacaattggatcactgctttggtcacatttggtgaaggttatcacaatttccatcac
gaattcccatcagattatagaaacgccattaaatggtaccaatatgacccaactaagatt
ttcatctttgtctcttacatcttcggtctatcgtacaatttacaaaaattctccaataac
gccattcaaatcggtatcattcaacaaaagattaaacaaattaataaagataaagcagct
ttgaattggggtccaagattgatcgatttgcctatttggaaagtccaagatttcgttgac
aatttggaaactaatccaaacttgattgttgtttcaggtattgttcatgatattaccaat
tacatcgatagacacccaggtggtcaaaagttgattaaagaagctagaggtaaagatgct
actagtgtctttaacggtggtgtatacaaccattccaacgcagctaacaatgtcttggct
acaatgagagttgctatgttggaagacaatttaccacaagctttcaaatttgcaaagaga
agaggtgaagtttatgatgagggcaagtttatgaagaatttataa

DBGET integrated database retrieval system