KEGG   Tetrapisispora blattae: TBLA_0C06220Help
Entry
TBLA_0C06220      CDS       T02489                                 

Gene name
TBLA0C06220
Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tbl  Tetrapisispora blattae
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:tbl01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:tbl01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:1507690..1509174
Genome map
AA seq 494 aa AA seqDB search
MLDDSSTKTESFSKRSTPEVGAGVQQKKIPSVNTEQANFVAAGLDKKTARVVNGLGSLMG
TKKMVDVQNSNSKVDIHISEQPWTLNNWYLKLNWLNFVLVVLIPAAGFYVAFKQWIPIKR
ETVLFALFYYVYAGITITAGYHRLWAHRAYSARWPLRLFFAFFGSANVEGSIKWWGHSHR
IHHRYTDTNKDPYDARKGLWYSHMGWMLVKPNPKYKARADISDLLEDPIVVFQHKHYIPL
MFLSGFILPCLVCGYFFDDYKGGFLYAGIIRIFLIQQATFCINSLAHYLGAQPFDNRRTP
RDNWITALVTFGEGYHNFHHEFPSDYRNAIKWYQYDPTKIFIFVSYIFGLSYNLQKFSNN
AIQIGIIQQKIKQINKDKAALNWGPRLIDLPIWKVQDFVDNLETNPNLIVVSGIVHDITN
YIDRHPGGQKLIKEARGKDATSVFNGGVYNHSNAANNVLATMRVAMLEDNLPQAFKFAKR
RGEVYDEGKFMKNL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgattcctctacaaagacagaatccttttcaaaaagatccactccagaagtt
ggtgctggagtgcaacaaaaaaagattccttcagttaatactgagcaagccaattttgtg
gctgctggtttggacaagaagactgcccgtgtggtgaacgggttagggtcgttgatgggg
accaagaagatggtggatgtgcaaaattccaacagcaaggtcgatattcatatttctgaa
caaccttggactttgaacaattggtatttgaaattgaactggttgaattttgttcttgtg
gttttaattcctgctgctgggttctacgtggcttttaagcaatggattcctatcaagaga
gagactgtcttgtttgccttgttctattatgtgtatgccggtattaccattactgcgggt
tatcacagattatgggctcatcgtgcttattcggctcgttggccattgcgtttatttttc
gcctttttcgggtctgctaacgtagaagggtctattaaatggtggggccattctcacaga
attcatcaccgttatactgataccaataaggatccatatgacgctagaaaagggttatgg
tattcacacatgggttggatgttggtgaagccaaatccaaaatacaaggctagagccgat
atcagtgatttattagaagatccaattgttgttttccaacacaagcattatatcccattg
atgtttctttccgggtttattttgccatgtttggtgtgtggttattttttcgatgattac
aaaggtggtttcttgtacgcaggcattatccgtatctttttaattcaacaagctaccttc
tgtatcaattctttggctcattatttgggtgctcaaccgtttgacaatagaagaactcca
agagacaattggatcactgctttggtcacatttggtgaaggttatcacaatttccatcac
gaattcccatcagattatagaaacgccattaaatggtaccaatatgacccaactaagatt
ttcatctttgtctcttacatcttcggtctatcgtacaatttacaaaaattctccaataac
gccattcaaatcggtatcattcaacaaaagattaaacaaattaataaagataaagcagct
ttgaattggggtccaagattgatcgatttgcctatttggaaagtccaagatttcgttgac
aatttggaaactaatccaaacttgattgttgtttcaggtattgttcatgatattaccaat
tacatcgatagacacccaggtggtcaaaagttgattaaagaagctagaggtaaagatgct
actagtgtctttaacggtggtgtatacaaccattccaacgcagctaacaatgtcttggct
acaatgagagttgctatgttggaagacaatttaccacaagctttcaaatttgcaaagaga
agaggtgaagtttatgatgagggcaagtttatgaagaatttataa

DBGET integrated database retrieval system