KEGG   Tetrapisispora blattae: TBLA_0C06610Help
Entry
TBLA_0C06610      CDS       T02489                                 

Gene name
TBLA0C06610
Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tbl  Tetrapisispora blattae
Brite
Enzymes [BR:tbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TBLA_0C06610 (TBLA0C06610)
Transcription machinery [BR:tbl03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     TBLA_0C06610 (TBLA0C06610)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:1596684..1598171
Genome map
AA seq 495 aa AA seqDB search
MVEKSESKRDGHEIFEDKVNIKKPKLLQDENININSGNEIATNSEEMHKEHQENLLQEND
SNQENQEGDHIKDNTLDNVKNQQDAGNHSVISEDQNKDVSVKANDEKDNDLEDNKPIGIQ
DEIADQDKGIIKFNFDGVDYKFKERSSVIEEKQGKIEFRVVNNDNTRENMMVLTGLKNIF
QKQLPKMPKEYIARLVYDRSHVSMTIIRKPLTVVGGITYRPFEDREFAEIVFCAISSTEQ
VRGYGAHLMNHLKDYVRGTTKIKYFLTYADNYAIGYFKKQGFTKDITLDKKIWMGYIKDY
EGGTLMQCSMLPRIRYLDAGKILLLQEAALMRVIMTKSKSHLVRKGLEQFKDLNNINPMD
PMDIPGLKEAGWTPEMDKLAQQPKRGPHYAAIQNILTEIQNHASAWPFLQPVNKEEVPDY
YEVIKEPMDLSTMEIKLENNRYEKMEDFIYDAKLVFNNCRMYNGENTSYFKYANRLEKFF
ISKVKEIPEYSHLVD
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaaaaagtgaatcgaaaagagatggacatgaaatttttgaagataaagtaaat
atcaagaaacctaaattacttcaggatgagaatatcaatataaactctggcaatgaaata
gctacaaatagtgaagagatgcataaagaacatcaagaaaacctgttacaagagaatgat
agcaatcaagaaaatcaagaaggtgatcatattaaagataatacgctggataatgtaaag
aaccagcaagatgctggtaatcattctgtgataagtgaagaccaaaacaaagatgttagc
gtgaaagctaatgatgagaaagataacgaccttgaggataacaagcctattggtattcaa
gatgaaattgcagatcaagacaagggtatcattaaatttaattttgatggtgttgattat
aaatttaaagaaagatcgagtgtcatagaggaaaaacaagggaaaattgaattccgtgtt
gttaataatgataatacaagggaaaatatgatggttttaactggtttgaaaaatatattt
caaaaacaattacctaaaatgccaaaagaatacattgcaagattggtttatgatagaagt
catgtttctatgacaattatacgtaagccactgactgtagttggtggaattacttataga
ccttttgaagatcgagaatttgcagaaattgtgttttgtgccattagttcaacagaacaa
gttcgcggttatggtgctcacttaatgaatcatttgaaagattatgtacgaggtacaaca
aagattaaatattttttgacttacgctgataattatgccattggttattttaaaaaacag
ggatttacaaaggacataacgctagataagaaaatttggatggggtatattaaagattat
gaaggtggtaccttaatgcaatgttcaatgttacctcgtatacgatatcttgatgcaggt
aagattttactattgcaagaagctgcattaatgagagttatcatgacaaaatctaaatct
cacttagttagaaaaggtttagaacaattcaaagatttaaataatataaatccaatggat
ccaatggatattcctggattaaaagaagcagggtggacccctgaaatggataagcttgct
caacagcctaaaagaggtccacattatgctgcaattcaaaatattctaacagaaattcaa
aatcatgcttctgcttggccattcttacaaccagtcaataaagaagaagtcccagattat
tatgaggttattaaagagccaatggatctaagcactatggagattaaattagagaataat
cgttatgaaaaaatggaggattttatttatgacgccaaattagtttttaataattgtagg
atgtataatggtgaaaatacttcatatttcaaatatgcaaataggttagagaaatttttt
atcagcaaagttaaggaaattcctgaatattctcatctggttgattga

DBGET integrated database retrieval system