KEGG   Tetrapisispora blattae: TBLA_0C06830Help
Entry
TBLA_0C06830      CDS       T02489                                 

Gene name
TBLA0C06830
Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tbl  Tetrapisispora blattae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tbl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(1648135..1648860)
Genome map
AA seq 241 aa AA seqDB search
MSNKDPVYNIQREDTPLRTKAASPYTLIAPVEEDGLSWPSIGSRTRSKESTVEEQARIKR
ISDAVKVILTEVGEDVEREGLLDTPERYAKAMLYFTKGYQTNILDDVIHNAVFEEDHDEM
VIVRDIEIYSLCEHHLVPFFGKVHIGYIPNKKVLGLSKLARLAEMYARRLQVQERLTKQI
AMALSDILKPLGVAVVIEASHMCMVSRGIQKTGSSTVTSCMLGGFRQHKTREEFLSLLNR
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtccaataaagaccctgtttataatatccaaagagaagataccccattacgtactaag
gctgcttctccatatactttgattgcacctgttgaagaagatggcttatcttggccctca
attggatctcgtacaagatctaaagaatcaacagtagaagaacaagcacgtattaaaaga
atttcagatgctgtaaaagtcatattaacggaagttggtgaagatgttgaaagagaaggt
ttgttggatactccagaaagatatgccaaggcaatgttatattttactaaaggttatcaa
accaatatactagatgacgttatacataatgctgtctttgaagaagatcatgatgaaatg
gtcattgtaagagatatagaaatatattctttatgtgagcatcatcttgtaccatttttt
ggtaaagttcacattggttatatacccaataaaaaagtacttggtttaagcaaattagca
cgtttagctgaaatgtatgctagaagattacaagttcaagaaagattaactaaacaaatt
gcaatggctttaagtgatatattaaaaccattgggcgtggctgttgttattgaagcctct
catatgtgtatggtatccagaggtatacagaagactggatcttctactgtcacttcatgc
atgttaggtggtttcagacaacataagacaagagaagaattcttaagtttattaaataga
aaatag

DBGET integrated database retrieval system