KEGG   Tetrapisispora blattae: TBLA_0D01010Help
Entry
TBLA_0D01010      CDS       T02489                                 

Gene name
TBLA0D01010
Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
tbl  Tetrapisispora blattae
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TBLA_0D01010 (TBLA0D01010)
Enzymes [BR:tbl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TBLA_0D01010 (TBLA0D01010)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:266269..267180
Genome map
AA seq 303 aa AA seqDB search
MKKFNLIFTISWALFNSLLIYGQNFYDSNPNIIELNSRTFDRVIHHTNYTTLVEFYAPWC
GYCQKLKPILEKTAKQLNGIVQIAAINCDLDMNKQLCGQESIEGFPTLKVFRPPKINFNV
KPEDRVDFKTHASEVYIGERKVSPMIDFMISRIKSYVKRVQNIKNLRNLICKKDKEQELK
VVYFSKNEKVSSVFKTLAIDFLGKVKFYHITNGVFKGFENDEVEINKSMKTYPNITKFLL
ELEKDQKDKNNSKNNRLVFFKAQEDKYLEYSGENFNKIDIESFIMKEFNITPTEGPLSKK
VSI
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttaacctcatatttactatttcatgggcattattcaattctttgttaata
tatggacaaaatttctatgattccaatccaaatatcattgagttaaattcaagaactttt
gatagagttattcatcacactaactacactactttggtggaattttatgcaccatggtgt
ggatattgtcaaaaattaaaaccaatattggaaaaaacagctaaacaattaaatggtata
gttcaaattgctgcaataaattgtgatcttgatatgaataaacaattatgtggccaagaa
tcaattgaaggtttccctactttaaaagtctttagacctcctaaaattaattttaatgtg
aaacctgaggatagggttgactttaaaactcatgccagtgaagtctatattggcgaacga
aaagtttcaccaatgattgattttatgatatcaagaatcaaatcttacgtaaaaagagtt
caaaacattaaaaatttaagaaacttaatttgcaagaaagataaagaacaagaattgaaa
gttgtttatttttctaaaaatgaaaaagtttcaagtgtatttaaaactctggcaattgac
tttttaggaaaagtaaaattttaccatattacaaatggagtttttaaaggttttgaaaat
gatgaagttgagattaataaatcaatgaaaacatacccaaacattactaaatttctgctt
gaattagaaaaagatcaaaaagataaaaacaattccaaaaacaatcgcctggtattcttc
aaagctcaagaagataaatatttagaatactcgggtgaaaattttaataaaattgatatt
gaaagctttattatgaaagaatttaatataacaccaacagaaggtccgctaagtaaaaag
gtgagtatataa

DBGET integrated database retrieval system