KEGG   Tetrapisispora blattae: TBLA_0D02140Help
Entry
TBLA_0D02140      CDS       T02489                                 

Gene name
TBLA0D02140
Definition
hypothetical protein
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
tbl  Tetrapisispora blattae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(539873..541243)
Genome map
AA seq 456 aa AA seqDB search
MTDTFSYDYKTVQNQPQFNYEFGSTYAPRVSYHFNPKVSSYHFGVRHPMKPFRLMLTDHL
VSGYGLHKIMDLYETRKASDDELLEFHTDDYINFLKKVNPDNVNKMPRGTLDKFNIGDDC
PIFHNLYEYSSLYTGASLDASRKLLNGQSDIAINWSGGLHHAKKTSPSGFCYINDIVLSI
LNLLRFHPRVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYNGEFFPGTGNYDETGCSNG
KHFALNVPLKDGIDDDSYINLFKSIIDPLITSYNPTVIIQQCGADSLGHDRLGCFNLNIK
AHGECVKFVKSFGIPMLVVGGGGYTPKNVSRLWTYETGILNNVLLSPELPSDIPFLNYFD
DEYSLYPVLDDLYENKNSKQFLEDLRIRCLEQIRYLKGAPSVRMDADVIPTQDLTKLTQD
EEDALKELNEEQDEEADQMRLAQIEKDNARICELVE
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgacagatacattctcatacgattacaaaacagtacaaaatcagccgcagtttaactat
gaatttggttcaacttatgcacccagagtttcttatcattttaacccaaaagtatcaagc
tatcattttggtgtacgacacccaatgaaaccctttcgcttaatgttgactgatcattta
gtttcaggctatggtctacataagattatggatttatacgaaacaagaaaggcttcagat
gatgaattgctagaatttcatacagatgattatattaacttcttaaaaaaagttaaccca
gataacgttaataaaatgccaagaggtacattagataaatttaatattggcgatgattgc
ccaattttccacaatttatatgaatatagttctctttatacgggtgcttcgttagatgca
tcaagaaaattgctaaatggacagtcagatattgccatcaattggtctggtggcttacat
catgccaaaaagaccagcccatctggattttgctatattaatgatattgttttatcgatc
ttaaatctattacgatttcatccaagagtcttatatattgatatcgatttgcatcacgga
gatggtgttcaggaagctttttatactacagatcgtgtttatactgtgtcatttcataaa
tacaacggcgaattcttcccaggaacaggtaattacgatgagactggctgttcaaatggt
aagcattttgctttaaatgttccattaaaggacgggattgatgacgattcatatattaat
ctttttaaatcaattattgatccattgattacttcttataatccaactgttattattcaa
caatgtggtgcagattcattgggccatgatagactaggatgctttaatttgaatataaaa
gcgcatggtgaatgcgtaaaattcgtaaaatccttcggaatacccatgcttgtagttggt
gggggtggctatactccaaaaaacgtatctcgtctttggacctatgaaactggtatctta
aataatgttctcttatcgcccgaattacccagtgatattcctttccttaattattttgat
gatgaatattccttatatcctgtactagatgacctttatgaaaataagaattcaaagcaa
tttttggaagacttaagaatacggtgtttagaacaaataaggtatttaaagggtgcgcca
agcgttaggatggatgcagatgttattccaactcaagatttaactaaattaacccaagat
gaagaggatgctcttaaagaactaaatgaggagcaggatgaagaggctgatcaaatgagg
ttagcacaaattgaaaaggacaatgctcgaatatgtgaacttgttgaatga

DBGET integrated database retrieval system