KEGG   Tetrapisispora blattae: TBLA_0D04190Help
Entry
TBLA_0D04190      CDS       T02489                                 

Gene name
TBLA0D04190
Definition
(RefSeq) hypothetical protein
  KO
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tbl  Tetrapisispora blattae
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TBLA_0D04190 (TBLA0D04190)
Enzymes [BR:tbl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     TBLA_0D04190 (TBLA0D04190)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(1036798..1037712)
Genome map
AA seq 304 aa AA seqDB search
MSISPVLFTLILIPLTFLIYKNFIKNSQANGNNKTKNNNEVLDGSDEVHSFPLISKIVMS
KSTSIYRFGLPNETDVLGLPIGQHISIKAPISEGKFILRSYTPITLDSMASGYFELLVKT
YTNGVVSTYLNDLKIGDYIQVVGPRGNYSYQRNMKSRIGMIAGGTGIAPMYQIMKAIAMD
PNDNTKVNLVYGSLSIDNILLKKELDELVEQRPNQFKVHYLVDRIEEPEIAKNWEGSIGY
ISPEIMKDHLPVNEKSNKNQILICGPPRMVSSIKRYVTTLGYERPKGVSKGQDPVFVFKF
QICI
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttctccggtattattcactcttattctaattccattaacatttttaatctat
aagaattttatcaagaattctcaagcaaatggcaacaataagactaaaaataacaatgaa
gtattagatggatctgatgaagttcattcattcccattaatctcgaagattgtaatgtct
aaatctacatcaatttatagatttgggttacctaatgagactgacgttttaggtttgcca
attggtcaacatatttccattaaagcaccaattagtgaggggaagttcatcttacgttct
tatacaccaatcacattagattctatggcaagtggttattttgaattattggtaaaaaca
tatactaacggggttgtatctacatacttgaatgatttgaagattggtgattatattcaa
gttgttggaccacgtgggaattacagttatcaaagaaacatgaaatctagaattgggatg
attgcaggtggtactgggattgctccaatgtatcaaatcatgaaagctattgctatggat
cctaatgataacacaaaggtgaatttagtttatggatcattatcgattgacaatatttta
ttaaagaaagaacttgatgaattagttgagcaaagaccaaaccaattcaaagttcattat
ttggtcgataggattgaagaacctgaaattgccaagaattgggaaggtagcattggctat
atctcacctgagattatgaaggatcatttaccagtgaatgaaaaatccaataagaatcaa
atattaatctgtggtcctccaagaatggtttcttcgatcaaaagatatgtcacaactttg
ggttacgaacgcccaaagggtgtgtccaagggacaagatccagtttttgtttttaagttt
caaatatgtatataa

DBGET integrated database retrieval system