KEGG   Tetrapisispora blattae: TBLA_0D04450Help
Entry
TBLA_0D04450      CDS       T02489                                 

Gene name
TBLA0D04450
Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
tbl  Tetrapisispora blattae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TBLA_0D04450 (TBLA0D04450)
Enzymes [BR:tbl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     TBLA_0D04450 (TBLA0D04450)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:1104255..1105916
Genome map
AA seq 553 aa AA seqDB search
MLKSVSKLPSNANVAVIGGGFTGLTFTYFLNKLRPDVKITIFEGQNRTGGWIESKRLQLN
DNDNNVIRFEKGPRTLRGVSDGTVLMVDMLEEIGKDTEAQLYHISKNAKANKQFLLDTNN
RLIQVPNSLKTLLKFSFNPLGKGLYKSLIGEWKRNGPANPQMDESVASLLTRRFGSDQIS
KNIMSALYRGIYAGDVKALSAQRTCNRMFLNDRKYGSFTKAIWNNIFHKKSKKEIDPSNS
PLLNPRLSIYQKAFHRDKTKIHELANTLKNYPLLGFKNGIETFPKLVRQYLEKSSNVNIH
CGNPVSSVIKNKKDMNKLIVELQDGKLYDTFDHVRFTINPEAIGQIMNKQDVSLSKELSK
VNSSTTVVVSYYLPNKNVIKKEYEGFGFLVPSSTDKSNLGKVLGVVFDSCVEHSFKPLAL
NKFFDDNKTTQTEIREKAKEYTKLTIMLGGYMLKNKDDPLFDRSKAIDIAKKTLHNVMDI
SEKDLDQGLWDYSVATNSLPQYFVGYDDWQKDVEKKFKDNFDNQVSLGGMGFARTPSLSD
LVLNNCQASIDLS
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagtcagtaagcaaattacccagcaatgccaatgttgcagtcattggaggtgga
tttacaggcttaacctttacgtattttttaaataagttacggccagacgttaaaattaca
atatttgagggtcaaaatagaactggaggttggatcgaatctaaaagattacaattaaat
gacaatgataataatgtgattcgattcgaaaaaggccctcgtactttaagaggtgtttct
gacggtactgtattgatggttgacatgttagaagagattggcaaagatactgaagctcaa
ttgtaccatataagtaagaatgcaaaagctaataaacaatttttattagataccaataac
cgattaattcaagtgccaaattcgttaaagacattattgaaattctcttttaatccattg
gggaaaggactttataaaagccttattggtgaatggaaaagaaatggacccgccaaccca
cagatggatgaaagcgtggctagtctattgacaagaaggtttggtagtgatcaaataagt
aagaatatcatgagtgcattatatagagggatttatgcaggcgatgtaaaggctttaagt
gcacaaaggacttgtaatcgaatgtttttaaatgatcgtaagtacggatcatttactaaa
gctatatggaacaatatcttccacaagaagtcaaaaaaagaaatagatccatcgaactca
ccattattaaacccaagattaagtatttaccagaaggcgtttcatcgtgataaaacaaag
attcatgagttagctaatacattaaaaaactacccattactaggtttcaaaaatggtatt
gaaacttttcccaaattagttcgtcagtatctagaaaaatcatcaaatgttaatatccac
tgtggtaacccagtttcatctgtaataaagaataagaaagatatgaataaactgatagta
gaattacaagatggtaaactgtatgatacttttgatcatgttcgttttactatcaaccct
gaagctattggccaaattatgaataaacaagatgtaagtttatcaaaggagttatcaaaa
gttaattcaagtactactgttgttgtcagttattatctaccaaataaaaatgtgattaaa
aaggagtatgaaggatttgggtttctagttccatcatcaactgataaaagtaatttggga
aaagtcttaggggttgtatttgattcatgtgtggaacacagttttaaaccgctagcatta
aataagttctttgatgataacaagacaactcaaactgaaatcagagaaaaagctaaagaa
tatacaaaattaactattatgttaggtggatatatgttgaaaaataaggatgatccatta
ttcgatagatctaaagctattgacatagccaaaaaaactttgcataatgtaatggatatt
tctgaaaaagaccttgaccaaggattatgggattattcagttgcaaccaattcattacca
caatactttgtaggttatgatgattggcaaaaggatgtcgaaaaaaagttcaaggacaat
tttgataaccaagtatctctgggtggtatggggtttgcaagaacccctagtctgtcagat
ttggttctaaataattgccaagcttctatcgacctatcttga

DBGET integrated database retrieval system