KEGG   Tetrapisispora blattae: TBLA_0E02050Help
Entry
TBLA_0E02050      CDS       T02489                                 

Gene name
TBLA0E02050
Definition
hypothetical protein
Orthology
K10747  
DNA ligase 1 [EC:6.5.1.1]
Organism
tbl  Tetrapisispora blattae
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    TBLA_0E02050 (TBLA0E02050)
   03410 Base excision repair
    TBLA_0E02050 (TBLA0E02050)
   03420 Nucleotide excision repair
    TBLA_0E02050 (TBLA0E02050)
   03430 Mismatch repair
    TBLA_0E02050 (TBLA0E02050)
Enzymes [BR:tbl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TBLA_0E02050 (TBLA0E02050)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:498038..500200
Genome map
AA seq 720 aa AA seqDB search
MSRYWLAARRPLSVTCRHYSCCRCRYYSFSPTLPLPMSKKQVTLARFFAKREPKDEEKQS
SSPVKEQVQIQGQPQQEQVKIQPQEQKQIVVPQEVTTSTQTPRPTKKSKPATSSLPYADL
CQLFETIESESSRLTITNLCTAFFSRTLQLDPSLLVPVTYLCINKLGPDYSGVELGLGEG
LLLKAIGSACGVSQQQLKLQYRKLGDLGQLAMSTRVLQPTITMFKLEPLTITKVFDTLAK
IAASQGKDSQNQKINMIKRLLTSCQGVEAKFLIRSLESKLRIGLAEKTVLTSLARALVIH
EKGNDNIQDDDYSNAEQIIKDSFCQIPNYEIIITTSLQYGVSQLASHIKLTPGIPLKPML
AKPTKSISEVLDTFQNIQFTSEYKYDGERAQVHLLPDGSMRIYSRNGEDMTQRYPELNIQ
DYLVDSTTTTQLILDCEAVAWDVELQKILPFQVLSTRKRKSVDLKDIKVRVCLFAFDILR
HNNDSLINNTLRERRDILHSITKPCPGQFQFATELTTSNLDELQTFLDKAIKDSCEGLMV
KSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLDLCVLGAYYGRGKRTGTYGGFLLACY
NQDTEEFETCCKIGTGFSDEMLQTLYNGLKETAIESPRANFVFDSSAEPDVWFNPTMVFE
VLTADLSLSPIYKAGSTVYGKGISLRFPRFIRIRTDKSVNDATSSEQVIDFYENQSHLQS
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgtcacggtattggctggcggctagacgtcctctctccgtcacgtgtcgccactacagt
tgctgtcgctgtcgctactattcttttagtcctacactaccgttacccatgagtaagaaa
caagtcactttggcaagattttttgccaagagagaacccaaagacgaagaaaaacaatca
tcatcaccagtgaaagaacaggtacaaatacaaggacaaccacaacaagagcaagtaaaa
atacaaccgcaagaacagaagcaaattgtagtgccgcaagaagtgacgacatcaacgcaa
actccgcgtcctacgaaaaaatcaaaacccgccacctcatcactaccttatgctgatctg
tgtcagttgtttgaaaccatcgaatctgaatcatctcgtcttaccatcacaaatttatgt
accgcttttttctctcgtacactacaacttgacccatctttactagtgcctgtcacttac
ttgtgtatcaataaattgggccccgactattcaggtgtagaattaggtcttggtgaaggt
cttctattaaaagccatcggttctgcatgtggtgtttctcaacaacaattgaaattacaa
tatagaaaattaggtgatttgggtcagcttgccatgtctactagagtattgcaaccaacc
atcaccatgtttaaattagaaccattaaccattacaaaagtattcgataccttagcaaaa
attgctgcttctcaaggtaaagactctcaaaatcaaaaaattaatatgattaaacgttta
cttacctcatgtcaaggtgtagaggccaaattcttgatccgttcattagaatccaaatta
agaatcgggttggctgagaaaactgtcttgacttcactagcgagagctcttgtcattcat
gaaaagggaaacgacaatatacaagacgatgactattctaatgcagaacaaatcatcaag
gattcattttgtcaaatccccaattatgaaattatcatcaccacttcattacaatacggt
gtttcacaattagcttcacatataaaattaactccagggatcccattgaaaccaatgttg
gcaaagcctacaaaatccatctccgaagtattggatacattccaaaatatccaattcact
tcagaatataagtatgacggtgaaagagctcaagtgcatttgttacctgatggctccatg
cgtatctattccagaaacggtgaagatatgactcaaaggtatccagaattaaatatccaa
gattatctggtagactctactaccacaactcaattaattttggattgtgaagctgtcgca
tgggatgtcgaattacaaaaaatcttacctttccaagtattaagtacacgtaagaggaaa
agtgtggatttgaaagacattaaagttagagtatgtttatttgcctttgatatattgcgt
cataacaatgattcattaattaacaacactttaagagaaagacgtgacattttacattca
attacaaaaccatgccctggtcaattccaattcgctacagaactaactacatcaaacttg
gatgaattacaaacgttcctggataaagctatcaaggattcttgtgaaggtcttatggtc
aaatccttggacggtacagattctcattatgagccaagtaagagatcaagaaactggctg
aaattgaaaaaagattatttacaaggtatgggggactcgctagatttatgtgtattgggt
gcctactacggtcgtgggaagagaacagggacatacggtggtttcttactcgcgtgttat
aatcaagatactgaagaattcgaaacttgttgtaagatcggtacagggttttccgacgaa
atgttgcagactctttacaatggtttgaaagagacagctatcgagtccccaagagctaat
tttgtttttgattcttcagcggaacctgatgtttggttcaatccaacaatggtctttgaa
gtgttgactgcagatttatctttgtcccctatttataaagcagggtccacagtttatggc
aaggggatttctctaagatttccacgttttataagaattagaactgataaatcagtaaac
gatgcgacttcttccgaacaagttattgatttctatgaaaatcaatctcacttgcaaagt
taa

DBGET integrated database retrieval system