KEGG   Tetrapisispora blattae: TBLA_0E04080Help
Entry
TBLA_0E04080      CDS       T02489                                 

Gene name
TBLA0E04080
Definition
hypothetical protein
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
tbl  Tetrapisispora blattae
Brite
Enzymes [BR:tbl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     TBLA_0E04080 (TBLA0E04080)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(1026669..1028753)
Genome map
AA seq 694 aa AA seqDB search
MSTSTTQDPLYRFHKQFQSFVQNNPNVISAARAASQIPESAKAVVVLSPYSLKHVFPRDW
VSKSYKKTIVERPERLLASSLGIAAAITMYPALFTLKSSHYKKSSLLSPHVLKVHGNDWP
RNLLEICKQADTKLQNNEIEVPDNWNAGDIYLSSKTIEALEGSIAAIETGIDSIFNGPSP
EHICNRAFVAIRPPGHHCKVATPSGFCLLNNAHISIEYAADHYGITHAVILDFDLHHGDG
TQDICWKRAGFRSEDEPEGSEGYDDFGKKFAEFPKVGYFSMHDINSFPTETGYATKVNIR
NASTCIMDGHDLNIWNIHLSPWNTEEDFQKLYQSKYRTLFAKADDYFRNAKYQMAQEGKP
FKGLVVISAGFDASEYEQTSMQRHNVNVPTNFYTMFTKDALKLAQIHCQGKVLSLLEGGY
SDKALTSGVFAHLIGFQNQNWINEWGSEQVVKEIVRGCKPHWKPYKTKKSRDVIRIWAEE
VIRLGRSMIPEYETSIVDDLRKNVTTNERVTQRITRSHDAKKTSSSSPRQQTSENDALQK
NLLLAESMKKENNIITSQTNSRRRVTSSGLHSVPFSKQDLPSDDEEDDDDYVYDEQLNKT
FNRTVEDITIDDISRHLETLELAYSDNDDDNNDYDNTTQKQKQKQKSSSSTRKSNNSQKP
NRTILNYDDSDISMISHVTPRRFQQHSTRSGARW
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgtctactactcaagacccattgtacagatttcataagcaattccaatcgttt
gttcaaaacaatccaaatgttatatctgcagccagggctgcttcacagatcccggaatct
gccaaggctgtggtagtattatcaccttattcattaaaacatgtatttccaagagattgg
gttagtaaatcctataaaaagactattgtggagagacctgaaagactcttggcatcctca
ttaggtattgcagcagctattaccatgtatcctgctttattcactttaaaatcttctcat
tataaaaaatcatccttattatctccacacgttttaaaagttcatggtaatgattggcca
agaaatttattggagatttgtaagcaagctgatactaaattacaaaataatgaaattgaa
gttcctgataattggaatgcaggtgatatttatttaagttcgaagacaattgaagcctta
gaaggtagtattgctgcaattgaaactggtatagattcaatattcaatggtccatcacct
gaacacatctgtaatagagcatttgtagcaatacgaccaccgggtcatcattgtaaagtt
gctaccccttctggattttgtctattaaataatgcccatatttcaattgaatacgctgct
gatcattacggcattactcacgcagtaatcttggatttcgatttgcatcacggcgatggt
acccaagatatctgctggaaaagagcagggtttaggtctgaagatgagcctgaaggttca
gaaggttatgatgattttggcaaaaaatttgctgaatttcccaaagtggggtatttttca
atgcatgatattaattcatttcctactgaaactggctatgcaacaaaagtaaatattaga
aacgcatctacttgtatcatggatggtcatgatttaaatatttggaatattcatttatct
ccatggaatactgaagaagattttcaaaaattatatcaatcaaaatatagaactttattt
gcaaaggcagatgattattttagaaatgcaaaataccaaatggcacaagagggtaaacct
tttaaaggtttagtggttattagtgcaggttttgatgcttctgaatatgagcaaacttct
atgcaaaggcataatgttaatgtcccaacaaatttttacacaatgtttactaaagatgct
ctaaaattggctcaaattcattgtcaaggtaaagttttatctttattggaaggtggctat
tctgataaagctcttacctctggtgtttttgcccatttgattgggttccaaaatcaaaac
tggattaatgaatggggttcagaacaagttgttaaggaaattgttcgtggttgtaaacct
cattggaaaccttataaaacaaaaaaatcaagagatgtaattagaatatgggctgaagaa
gtaataagattaggaagatcaatgattcctgaatatgaaacctcgattgttgatgattta
agaaagaatgtaactactaacgagcgagtcacacaaagaataacaagatcacatgatgct
aaaaagacatcatcatcatcaccaagacaacaaacttcagaaaatgatgcattacagaaa
aacttactattggcagaatcgatgaaaaaggaaaacaatattattacatcacaaaccaat
agcagaaggcgtgtcacatcaagcggtttacattctgttccattctctaaacaagattta
ccaagtgatgatgaagaagatgatgatgattatgtttatgatgaacagttaaataaaacg
tttaaccgtacagttgaagatattaccattgatgatatatcgagacatttagaaacttta
gaacttgcatattctgataacgatgatgataataatgattatgataacaccactcaaaag
caaaagcagaaacaaaaatcatcttctagtacaagaaaatctaataactctcaaaaacca
aatagaacaattttaaattacgacgatagtgacatatctatgatttctcatgttacgcca
agaagatttcagcagcatagcaccagaagtggtgcaagatggtaa

DBGET integrated database retrieval system