KEGG   Tetrapisispora blattae: TBLA_0F02610Help
Entry
TBLA_0F02610      CDS       T02489                                 

Gene name
TBLA0F02610
Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
tbl  Tetrapisispora blattae
Brite
Enzymes [BR:tbl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TBLA_0F02610 (TBLA0F02610)
Peptidases [BR:tbl01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   TBLA_0F02610 (TBLA0F02610)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:634026..634736
Genome map
AA seq 236 aa AA seqDB search
MSSSRSVVPLESNPEVFATFAHNLGLRSSYGFTDIYSLTDPEILAFTPRPIKAIILLFPI
NEITESASKNDNSQTGKVNVTKNPVWFKQTIKNACGLYALLHSLSNNQELLNKDCELTEF
LLANSSKDGKYEDKATDDFIVNISERFSNNFNEGQTSAPDPNEDINLHFITFVESNNKIF
ELDGRRPNGAFELGDASSSAMDLADQDLVKKRVQWYMDSANESDKLKFSLLALISI
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctagtcgttctgttgtgccattagaatcaaatcctgaagtgttcgccacattt
gctcacaatttaggtttacgatcatcatatggattcaccgatatctactccttaacagat
cctgaaatacttgcatttaccccaagaccaattaaagccattattttacttttccccatt
aacgaaataactgaaagtgctagcaagaatgataattcacaaactggaaaagtaaatgtg
actaaaaacccagtatggttcaaacaaacaattaaaaatgcatgtgggttgtacgcattg
ttgcattctttgtcaaacaatcaagaattattaaataaggattgtgaacttactgaattt
cttctagctaattcaagtaaagatgggaagtatgaggacaaagcaacagatgattttatt
gtaaatattagtgagcgattttcaaataattttaatgaaggtcaaacttctgctccggat
ccaaatgaagatataaatttacattttattacttttgttgaatcaaataataaaatattt
gaactagatgggagaagaccaaatggagcattcgaattaggcgatgcttccagcagcgca
atggatctggctgaccaagatttagtgaaaaaaagagttcagtggtatatggatagcgca
aatgaatcagataaattaaaattctctctactagcactaatatctatataa

DBGET integrated database retrieval system