KEGG   Tetrapisispora blattae: TBLA_0F03060Help
Entry
TBLA_0F03060      CDS       T02489                                 

Gene name
TBLA0F03060
Definition
hypothetical protein
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
tbl  Tetrapisispora blattae
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TBLA_0F03060 (TBLA0F03060)
   01210 2-Oxocarboxylic acid metabolism
    TBLA_0F03060 (TBLA0F03060)
   01230 Biosynthesis of amino acids
    TBLA_0F03060 (TBLA0F03060)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TBLA_0F03060 (TBLA0F03060)
Enzymes [BR:tbl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     TBLA_0F03060 (TBLA0F03060)
Amino acid related enzymes [BR:tbl01007]
 Aminotransferase (transaminase)
  Class I
   TBLA_0F03060 (TBLA0F03060)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:743646..745148
Genome map
AA seq 500 aa AA seqDB search
MTMNQKTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYA
NIGNPQQLDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSV
GAYSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAK
DESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPT
TLVVINPGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSEL
RKNYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVT
GQILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMY
LFPRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPP
GIEWINSWEKFHLEFMEKYK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgactatgaatcagaaaacgttcctgcctgctccaaaattctctttgaacgatatcaat
gaatccatactaaaggcagaatacgccatcagaggtaccatccccaatagagccgaagaa
ctggatatccagttgttggaaaacagcaagtctttgcccttcgccaaaatcgtctatgcc
aatatcggtaaccctcaacaattggatcaacaacctttgactttccaaagacaagtcatg
tcgttggtacaattccccgacttgttgaaatcaaaagatattttgttggctcaaaaaata
tattccaaagattccatagaaagggccactaaattgctaaattccataggtggctccgtc
ggcgcttattcttcttcacagggggtcttggacatccggaaaaacgtcgcaagattcatc
ttgaaaagagatttacatcacgaccctactcaagatttgatcgatgaaactgcaagtaat
gtgtttttaacagctggtgcttccaccgcggtagatcatatcttacccttgtttgctaaa
gatgaaagttgcggcgtcttattaccaatccctcaataccccttgtataccgctgcagtc
actttacaaaaatcaaaattgttaccttattatttaaatgaatcaaacaattggtccaca
gatccaaaacagattgagcagatcgtcatcgatgccatcaaacaaaatattaaaccaact
actctagtcgtcattaatccaggtaaccccaccggtgccatattaacaaaggattccata
atagatattatagatatcgctgccgaatatgggatcgtcatcattgctgatgaagtttat
caggaaaatgtctatgaagcttttgaattccattcatttaaaaaagtcttgagtgaattg
aggaaaaattatccttctaaatatgataatgttcaattggcatctttacattctatttca
aaaggtgttaatggtgaatgtggtcaaagaggtgggtatatggaaatcacagggttttcc
aatgatgttaagaaagttttattaaaagtcgcctccattagtatttgttcagtggtcaca
ggtcaaatcttggttgatttgatggtaaatccacctcaaccaggagatgaatcctatgaa
ttggatcaattagaaagatcagtcattcattcaaacttgatcttgaaatcaaacactctt
tacgacgttttcacaagattgccggggatctcatgtcaaaaacctcaaggtgcaatgtat
ttgttcccaagattacatttatcagaaaatgctataaatgccgctacagaacttaatttg
aaaccagatgaattttattgtttgaaattattggaaaatactgggatttgtactgtgcca
ggttcaggtttcggtcaatatccaggtacttatcatttaagaacaacatttttacctcca
ggtattgaatggatcaattcttgggaaaaattccatttggaattcatggaaaaatataaa
taa

DBGET integrated database retrieval system