KEGG   Tetrapisispora blattae: TBLA_0G01040Help
Entry
TBLA_0G01040      CDS       T02489                                 

Gene name
TBLA0G01040
Definition
hypothetical protein
Orthology
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
tbl  Tetrapisispora blattae
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    TBLA_0G01040 (TBLA0G01040)
Enzymes [BR:tbl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TBLA_0G01040 (TBLA0G01040)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(258966..261884)
Genome map
AA seq 972 aa AA seqDB search
MNSSNEVIIPVSTTTKESPATTPKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISN
KPISTRYFDTITHFIKLWRTTIGDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLP
KNSVVERRLIRWKYKADRYETLATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVN
RQNWNNKKRSNLLQVETFKFCLENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKE
YLSVVSDLRTLSNKLWNPSIKINNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFI
EEKMDGERIQLHYMNYGETVKFFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDG
EMVTFDSTSKKVLPFGLVKSSASSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFK
RKEFLNTVLTPYKDYVEILSSIRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARH
NNWIKVKPEYLEEFGENMDLIVIGRDSGKKDCLICGILVTEEKQELSENMKRESEIEIIS
DSGDDDLDTKPSQGIKKVISFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFG
TKKPVEWIYPQDSVVLEIKARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLH
DLTYNEIKRHEKKNKNKQTLIRSYSRKKSKIISPAGMLPNGTDLRLISDLFHGLYFYIIS
DYIPDSDAQRIDREDICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGY
DVINLSWLFDCLQAGVILPLEPAHCLFVSNELLAIATDRIDKFGDSYEATLIDSKLLKLL
DSNINKVNRSNSNLLLINKDEGVDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGG
SLVTKLEDCNIIVGVCGSQLVNKKLGDLRCKLVKQYVDANFPQPIPRAVNVSWITESIKA
GYQLSPEDYPIL
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atgaattcttcaaacgaagtaataataccagtaagtacaactacaaaggaaagcccagcc
acaactccaaaaaattttgcaccctcacctgatttcaaatggttatgtgatgaattattt
gttaaaatagataaaattagagaacaaatcaaaaataaaaccgctaatactatatcaaat
aaacctatttctacaaggtattttgatactataacacattttataaaattatggagaacc
actataggtgatgatattttccctgcattgagattaattcttccttatagagatcgtaga
gtttataatattaaagatctcactttgattagagctatctgttcatatttaaaattaccc
aagaattcagtagtggaacgaagattaattcgttggaaatataaagcagatcgttatgaa
acgttagctacattttgtattcatgaaatttccaagagaaaaaatgaaccgcaagtcaca
caagttgaaagaatatcaattgataaattgaacgaaatattggatgatttggtcgttaat
cgtcaaaattggaataacaagaaacgttctaatttattacaagtagaaacattcaaattt
tgtttagaaaatatgacatttattgaattaaaatatttttttgacatcattgtaaagaat
aaaatacttggaagtcttgaaaatatgtttttgaaaatatggcatccagattccaaagaa
tatttgagtgttgtatcagatttacgtaccctatcaaataaattatggaatccttccatt
aaaattaataattctgatttatcaattaaagtaggttatatatttgccccacaattagca
aaaagattgatgttatcatatgatacaatatcaaatagacttaacaatgattttttcatt
gaagaaaaaatggatggagaaaggattcagctacattacatgaattacggtgaaacagta
aaatttttcagcaggcatggtactgattatacttacctttatggaaatgataaatctgcc
ggaaccattgctaagtttttacggctgcacaaaaacgtgaaagaatgtgttcttgatggt
gaaatggttacttttgatagcacaagtaaaaaggttttaccatttggtctagtaaaatct
agtgcttcatcacagttaaataaaaaggatattgataatgactcatttcatcctttattt
atggtgtttgatattctatatttaaatgggtcttctttaatcgatttaccattgtttaag
agaaaggaatttctaaatactgttttaaccccgtataaagattatgttgaaatcctgagt
tctataagatgtactgatagtatacaaatcaagaaaggacttgatgcagctattagtgta
ggatctgaaggtattgtgttaaaacaatatatatctaaatatataccaaatgccagacat
aacaattggattaaagttaaaccagaatatttagaagaatttggtgaaaatatggattta
atcgtcattggacgagattctggtaaaaaagattgtctaatttgtggtatattagtaacc
gaggagaaacaagaattaagtgaaaatatgaaaagagaatcagagattgaaattatatcc
gatagtggtgatgacgatttagatactaagccatctcaagggattaaaaaagtaatatcc
ttttgtacaattgcaaatggattatcacaaaacgaattaaaggaaatcaatcgcattact
agaggtgcttggaaaaattacaataatgaaacgccgccaatagatgttctagaatttgga
actaagaaaccggtagaatggatttatccgcaggattctgtggttttagaaatcaaagct
agatctcttgaccgaacagaccaaacccaatataaatatgcgactggatgcacattatat
ggtggatattgtagacaaatccgtcaagataaggattggacttcttgttacacattgcat
gacctaacttataatgaaattaagagacatgaaaaaaagaataaaaataaacaaactttg
atcagatcttatagtagaaagaagagcaagattatttcaccagcaggtatgcttccaaat
ggtactgatttgcgtctaatctcagatttatttcatggactatacttttacattatatca
gactatatacctgattctgatgctcaacgtattgatagagaagatatttgctctttaatt
ataaaaaatggtggaagagtcatctataatgtgatagctaaaacctacactatttcaaag
ctaagaatattgagttccaaatctacaatcgagtgcacagatcttgtaagaagaggctat
gacgtaataaatttgagctggttgttcgattgtcttcaagcgggagttatcttgccccta
gagccggcacattgtttattcgtctcgaatgagttgttagctatagctacggatagaata
gataaatttggtgatagttatgaagctacacttattgattcgaaattattgaaattgctt
gactcaaatattaataaggtaaatcgttcaaatagtaatctacttctgattaataaggat
gaaggagtggactctataccaatatttttatttaccaatcgtaaatttttcttgattaaa
gaggatattttattaggtgaccgtgacactcttatatttcaaattaaattatatggtggt
tctttggtaacaaagctagaggattgtaatattattgtaggagtttgcggatcacaatta
gtaaataaaaagcttggtgatcttcgatgtaagttagtaaagcaatatgttgatgcaaat
ttcccacagccaattccccgtgccgtgaatgtttcctggatcactgaatcaattaaagca
ggataccaactttcaccagaagattatcctattttataa

DBGET integrated database retrieval system