KEGG   Tetrapisispora blattae: TBLA_0H00310Help
Entry
TBLA_0H00310      CDS       T02489                                 

Gene name
TBLA0H00310
Definition
hypothetical protein
Orthology
K11401  
histone acetyltransferase SAS2 [EC:2.3.1.48]
Organism
tbl  Tetrapisispora blattae
Brite
Enzymes [BR:tbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TBLA_0H00310 (TBLA0H00310)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:55426..56382
Genome map
AA seq 318 aa AA seqDB search
MKLEKKNADDNPEEELYGIQKERNIRQVQFGLGKKFLTWYGSNVYFNKSTRLLGYINMPK
SPGKKGKIQSPVGQYWLDTLYICEYCFKYTDQLKELESHISHCLYAKKAPGRIMYKSPDI
TIRRVKGWKHELYCQCLCLFTKLFLDNKSMYFKLPHYEFYIIYKTGSTKPMGYFSKDILS
YARYNLACILTFPPYQRQHVGTYLMEFSYKLSKLEGIASGPETPLSPFGLISYINYWSRI
IAMELLEGELMGYNYVTLEMISKVTGFRISDIITTFKQLDCLDENDNILLNKLKMWAKGK
SKHLKGYYLDNEYFLADA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggagaagaaaaatgcagatgataatcctgaagaagaattgtatggtattcaa
aaggaacgtaatattaggcaagttcaatttggactaggcaagaaatttctgacttggtat
ggtagtaatgtttattttaacaaatctacgcgattattaggatatatcaatatgccaaaa
agccctgggaaaaagggtaagatacagtcaccagtaggtcaatattggttggatacactt
tatatatgtgaatactgctttaagtatacagaccaactgaaagaactagagtctcatatt
agtcattgtttatatgcaaaaaaagctcctggccgaataatgtacaagagccctgatatc
acaataagacgggtgaaaggttggaagcatgaattatattgtcaatgtctatgtctattc
actaaattatttttagataataaatcaatgtattttaaattgccacattatgagttttat
atcatctataagacaggttccacgaaaccaatgggctatttttcaaaggatatattgtca
tatgccagatataatttagcctgtattttaacatttccaccttatcagagacagcatgtt
gggacgtacttgatggaattttcttacaagttatcaaagttagaaggtattgcttcaggt
cctgaaacacctttatcgccttttgggttaattagctacataaattactggtcaagaatt
attgctatggaattattagaaggtgagttaatgggttataattatgttacactggagatg
atatcaaaagttacagggttcagaatatcagatatcattacaacgtttaagcagctggac
tgtttggatgaaaatgataatatcttacttaacaagttgaagatgtgggctaaaggaaaa
agtaagcatttaaagggttattatttagataatgaatattttctggctgacgcatga

DBGET integrated database retrieval system