KEGG   Tetrapisispora blattae: TBLA_0H01330Help
Entry
TBLA_0H01330      CDS       T02489                                 

Gene name
TBLA0H01330
Definition
hypothetical protein
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
tbl  Tetrapisispora blattae
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    TBLA_0H01330 (TBLA0H01330)
Enzymes [BR:tbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TBLA_0H01330 (TBLA0H01330)
Protein kinases [BR:tbl01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   TBLA_0H01330 (TBLA0H01330)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(297718..299163)
Genome map
AA seq 481 aa AA seqDB search
MSGNEEFIRTQIFGTVFEITNRYTDLNPVGMGAFGLVCSANDTLTNQPVAIKKIMKPFST
AVLAKRTYRELKLMKHLTHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPLEKQF
VQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTR
YYRAPEIMLTWQKYDTEVDIWSAGCIFVEMIEGKPLFPGKDHVHQFSIITDLLGSPPPDV
INTICSENTLKFVTSLPHRNPVPFNERFNTLENDAIDLLEKMLIFDPKKRITASDALAHP
YLAPYHDPSDEPVAEHKFDWHFNDADLPVDTWRVMMYSEILDFHKIGGENGQIDTTATFD
DQVAAATAAAAAATAAAQAQAHSQQHLQQQQQQLQQQKQQQLQHQQLQQQQQQQQQQLQH
QQQHNNALNSIEDPNMQMHQGSQTNNDLQKQNNISNNTSNQDQILSYGDQAIQYANEFQQ
N
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaaacgaagaatttattagaacccaaatctttgggactgtctttgaaatcaca
aacagatatactgacctaaatcctgtcggtatgggtgcctttggtttagtctgttctgct
aatgatactttaacaaatcagccagtggcaatcaagaaaatcatgaaaccattttctact
gcagtcttggccaagagaacttatagagaattaaaactgatgaaacatttgacgcatgag
aatttgatttgtttacaagacatctttttgtctcctttggaagatatttattttgtcaca
gagttacaaggtaccgatttgcaccgtctgctacaaactagacctttagaaaagcaattt
gtgcagtacttcttgtaccagatcctgaggggtttaaaatacgtccattcagcaggtgtc
atccatagagatttaaaaccaagcaatattctaattaatgaaaattgtgatttaaaaatc
tgtgatttcggtctagctagaattcaagatccacagatgactgggtacgtttcaacaaga
tactacagagccccggaaatcatgttgacttggcagaagtatgataccgaggtggatatt
tggtctgctgggtgtatctttgtggaaatgattgaaggtaaacctttatttccaggtaaa
gatcatgttcatcaattctctattataactgatttattaggttccccaccaccagatgtc
atcaatactatttgctctgaaaacactttgaaatttgtcacttccttgccacatagaaat
cctgttcctttcaatgaaaggtttaatactttagaaaatgacgctatagatctcttagaa
aaaatgttgatattcgatcctaaaaagagaattactgcctctgatgccttggctcatcct
tatttagctccttatcacgatcctagtgacgaaccagttgctgaacataaattcgattgg
catttcaatgatgctgatttacctgtcgatacttggcgtgtaatgatgtattcagaaatt
ctagatttccataagattggtggtgaaaatggtcaaatcgacacaactgctacattcgat
gaccaagtggccgctgctactgcggcggccgccgccgctaccgccgcagctcaagctcaa
gctcattcacaacaacatttacaacaacaacaacaacaattgcaacaacagaaacaacaa
caattgcaacatcaacaattgcaacagcaacagcagcaacaacaacaacagttgcaacat
caacagcaacataacaatgcactaaatagcatagaagacccaaatatgcaaatgcatcaa
ggctctcagactaataatgatcttcagaaacaaaataatatatcaaataatacatccaat
caagatcagatattaagttatggtgaccaagctattcaatatgcaaatgaattccaacag
aactaa

DBGET integrated database retrieval system