KEGG   Tetrapisispora blattae: TBLA_0H03350Help
Entry
TBLA_0H03350      CDS       T02489                                 

Gene name
TBLA0H03350
Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tbl  Tetrapisispora blattae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TBLA_0H03350 (TBLA0H03350)
Enzymes [BR:tbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     TBLA_0H03350 (TBLA0H03350)
Exosome [BR:tbl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TBLA_0H03350 (TBLA0H03350)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(821868..823556)
Genome map
AA seq 562 aa AA seqDB search
MESTGLISGIPKNADSVTTIKSKLSLYKIRRFWKQIILSLLAVSIFLTLISPSVTLKNTS
QKKNVIFFVTDGMGPTSLSLARSFKQHVYNLPIDDVLTLDKHLIGSSRTRSSDSLITDSA
AGATAFSCRLKTYNGAIGIDPQKNPCGTLLEAAKLQGYMTGLVVTTRITDATPASFSAHA
DYRFQEDLIASQQLGNYPLGRMVDLLMGGGRSHFYSSNSKDSEWVGNGGARADDRNLIQE
ALDEGWSYVGDRASFDDLQNGFNVSLPLLALLADNDIPFDFDRDPTVHPSLKEQAMTAIN
ALDEATKDSDEGFFIMIEGSRIDHAGHQNDPASQAREVLAFDEAFEAVLDYVSKTDTETI
VLSTSDHETGGLVTAKQVTRTYPDYIWFPEVLANSTHSGEYLKKVYSNFIKFSNNLTRNE
IKNFIKKEIFENGLHIFDYREKDVLDIMSYKDVNEVQEKLNRMISWRAQIGWTTHGHSAV
DVNIYAYSNRKTTWYRILDKLQGNHENTEIGKFMEEYMNLNLDDVTDMIQDTVHHPDMTA
KELENMDEFADEYFHHLKISLD
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggaatctacaggccttatttctggaattccaaaaaatgctgattctgtaacaacaatc
aaaagtaaattatctctctataaaattcgaaggttttggaaacaaataatattaagctta
ttagctgtctcgatttttttgactctaatatccccaagtgtcactctaaagaacacgtct
caaaaaaagaatgttattttctttgtcactgatggaatgggtccaacttcattgtcatta
gcccgttcatttaagcaacatgtttacaatttacctatagacgatgtcttgactttagat
aagcatttaattggttcttcaagaacaagatcgtccgattcattaattactgattcagcc
gcaggtgctactgcattttcatgtagattaaagacctataatggggctattggtattgat
ccacaaaagaatccatgtggaaccttgttagaagctgctaaactacaaggttatatgact
gggttagttgtaacaacaagaattacagacgcaactcctgcctcgtttagtgctcatgca
gattatagatttcaagaggatctaattgcatctcagcaattgggtaattatccattgggc
aggatggtagatttattaatgggtggtggtagatcgcatttctactcctcaaattccaaa
gatagtgaatgggttggtaatggtggtgcacgtgccgacgatagaaatctaattcaagag
gctcttgatgaaggttggtcctatgtaggtgatagagcaagttttgatgatttacagaac
ggtttcaacgtttcattaccactattagcattactagctgataatgatattccttttgat
ttcgatagagatccaacagtccatccttctttgaaagagcaagcaatgactgccattaat
gcccttgacgaggctacaaaagattcagatgaaggtttctttattatgattgaaggttca
cgtattgatcatgcaggtcaccaaaatgaccctgcatctcaagctcgtgaagtattggcc
tttgatgaagcttttgaagctgttttagattacgtctcaaaaacagatactgaaacaatc
gtattatccacttctgaccatgaaactggtggccttgtcactgctaagcaagtcactaga
acctatccagattatatttggttccctgaagttttggcaaactcgactcattcaggtgaa
tatttaaaaaaagtttattccaatttcattaaattttcaaataatttaacaagaaatgaa
attaaaaattttattaaaaaggaaattttcgaaaatgggttacatattttcgattataga
gaaaaagatgtattggatattatgtcatataaagatgtaaatgaagttcaagaaaagctt
aacaggatgatctcctggagagctcaaataggttggactacacatggtcattctgctgtt
gatgttaacatttatgcatattcaaataggaaaacaacttggtataggattttggataaa
ttgcaaggtaatcatgaaaatacagaaatcggtaaattcatggaagaatatatgaatttg
aatttggacgatgtcactgatatgattcaagatacagtccatcatccagatatgactgca
aaggaactcgaaaatatggatgaatttgcagacgaatatttccatcatttgaaaatttct
ctagattaa

DBGET integrated database retrieval system