KEGG   Tetrapisispora blattae: TBLA_0I03540Help
Entry
TBLA_0I03540      CDS       T02489                                 

Gene name
TBLA0I03540
Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
tbl  Tetrapisispora blattae
Pathway
tbl00010  Glycolysis / Gluconeogenesis
tbl00051  Fructose and mannose metabolism
tbl00052  Galactose metabolism
tbl00500  Starch and sucrose metabolism
tbl00520  Amino sugar and nucleotide sugar metabolism
tbl01100  Metabolic pathways
tbl01110  Biosynthesis of secondary metabolites
tbl01130  Biosynthesis of antibiotics
tbl01200  Carbon metabolism
Module
tbl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tbl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TBLA_0I03540 (TBLA0I03540)
   00051 Fructose and mannose metabolism
    TBLA_0I03540 (TBLA0I03540)
   00052 Galactose metabolism
    TBLA_0I03540 (TBLA0I03540)
   00500 Starch and sucrose metabolism
    TBLA_0I03540 (TBLA0I03540)
   00520 Amino sugar and nucleotide sugar metabolism
    TBLA_0I03540 (TBLA0I03540)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TBLA_0I03540 (TBLA0I03540)
Enzymes [BR:tbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     TBLA_0I03540 (TBLA0I03540)
Membrane trafficking [BR:tbl04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    TBLA_0I03540 (TBLA0I03540)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 14498184
NCBI-ProteinID: XP_004182526
UniProt: I2H9F5
Position
9:complement(847840..849300)
Genome map
AA seq 486 aa AA seqDB search
MVHLGPKKPPARKGSMIDVPEELIEQIHGLETIFRATPEKLQAVTKHFISELDKGLSKKG
GNIPMIPGWVVEYPTGKETGDYLAIDMGGTNFRVALIKLGGDHTFDTTQSKYKLPDELRT
TQHPEELFAFLADCIESFLEEQFPDGVTGTLPLGFTFSYPASQNKINEGILQRWTKGFDI
PNVEGHDVVPMLKKQLAKRKLPVDVVALINDTTGTLVASLYSDPDTKMGVIFGTGVNGAY
YDMVKNIPKLEGKLADDIPANAPFAINCEYGSFDNEHVALPRTKYDVMVDEQSPRPGQQT
FEKMSSGYYLGELLRLVLVDLHAQGFILKDQDLTKLNVPYCMDTSYPSRFEDDPFENLEN
VAEIFEKDFGIKTTSPERKLIRKLSEAIGLRSARLSVCGIAAICQKMGYETGHIAADGSI
FKMYPGFPEKAALGLKDIYGWKETDPKKMPLRLVDAEDGSGAGAAIIAALAEKRLAAGKS
VGLIGA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggttcatttgggtccaaagaaaccacctgcaagaaagggctctatgatcgatgtccca
gaagaattaattgaacaaattcatgggttagaaactattttcagggctactccagaaaaa
ttacaagctgtcactaagcatttcattagtgaattagataaagggttgtccaagaaaggt
ggtaacatcccaatgattccaggttgggttgttgaatatccaactggtaaagaaactggt
gattatttagctatcgatatgggcggcactaatttcagagtcgcgttaattaaattaggt
ggtgatcatacttttgacactactcaatcaaaatataaattaccagatgaattgagaact
actcaacatccagaagaattatttgcatttttagctgattgtattgaatccttcttagaa
gaacaattcccagatggtgttactggtactttaccattaggtttcactttctcataccca
gcttctcaaaacaagattaacgagggtatcttacaaagatggactaaagggtttgatatt
ccaaatgtagaaggccatgatgtggttccaatgttgaagaaacaattagcaaagagaaag
ttacctgtcgatgttgttgctttgattaacgataccactggtactttagttgcttccttg
tattctgacccagataccaagatgggtgttattttcggtaccggtgtcaatggtgcttat
tatgatatggttaagaacattccaaagttggaaggaaagttagctgatgatattccagcc
aatgctccatttgccattaattgtgaatatggttcttttgataatgaacacgttgcttta
ccaagaactaaatatgatgttatggttgatgaacaatctccaagaccaggtcaacaaact
ttcgaaaagatgtcttctggttactacttaggtgaattattacgtttggttttagttgat
ctgcatgctcaaggctttatcttgaaggatcaagatttaactaaattaaacgtcccatac
tgtatggatacatcttatccatctagatttgaagatgatccatttgaaaatttggaaaat
gttgctgaaatctttgaaaaagacttcggtattaaaactacttctccagaaagaaaattg
atcagaaaattgtctgaagctattggtttaagatctgccagattatctgtttgtggtatt
gctgctatttgccaaaagatgggttatgaaactggtcatattgctgctgatggctctatc
ttcaaaatgtacccaggtttcccagaaaaggctgccttaggtttaaaggatatttatgga
tggaaagaaactgatccaaagaagatgcctttgagacttgtcgatgctgaagatggttcc
ggtgccggtgccgccatcattgctgctttagccgaaaaaagattggctgctggtaagtca
gttggtttaatcggtgcttaa

DBGET integrated database retrieval system