KEGG   Tetrapisispora blattae: TBLA_0I03540Help
Entry
TBLA_0I03540      CDS       T02489                                 

Gene name
TBLA0I03540
Definition
hypothetical protein
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
tbl  Tetrapisispora blattae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TBLA_0I03540 (TBLA0I03540)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TBLA_0I03540 (TBLA0I03540)
   00051 Fructose and mannose metabolism
    TBLA_0I03540 (TBLA0I03540)
   00052 Galactose metabolism
    TBLA_0I03540 (TBLA0I03540)
   00500 Starch and sucrose metabolism
    TBLA_0I03540 (TBLA0I03540)
   00520 Amino sugar and nucleotide sugar metabolism
    TBLA_0I03540 (TBLA0I03540)
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    TBLA_0I03540 (TBLA0I03540)
Enzymes [BR:tbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     TBLA_0I03540 (TBLA0I03540)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:complement(847840..849300)
Genome map
AA seq 486 aa AA seqDB search
MVHLGPKKPPARKGSMIDVPEELIEQIHGLETIFRATPEKLQAVTKHFISELDKGLSKKG
GNIPMIPGWVVEYPTGKETGDYLAIDMGGTNFRVALIKLGGDHTFDTTQSKYKLPDELRT
TQHPEELFAFLADCIESFLEEQFPDGVTGTLPLGFTFSYPASQNKINEGILQRWTKGFDI
PNVEGHDVVPMLKKQLAKRKLPVDVVALINDTTGTLVASLYSDPDTKMGVIFGTGVNGAY
YDMVKNIPKLEGKLADDIPANAPFAINCEYGSFDNEHVALPRTKYDVMVDEQSPRPGQQT
FEKMSSGYYLGELLRLVLVDLHAQGFILKDQDLTKLNVPYCMDTSYPSRFEDDPFENLEN
VAEIFEKDFGIKTTSPERKLIRKLSEAIGLRSARLSVCGIAAICQKMGYETGHIAADGSI
FKMYPGFPEKAALGLKDIYGWKETDPKKMPLRLVDAEDGSGAGAAIIAALAEKRLAAGKS
VGLIGA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggttcatttgggtccaaagaaaccacctgcaagaaagggctctatgatcgatgtccca
gaagaattaattgaacaaattcatgggttagaaactattttcagggctactccagaaaaa
ttacaagctgtcactaagcatttcattagtgaattagataaagggttgtccaagaaaggt
ggtaacatcccaatgattccaggttgggttgttgaatatccaactggtaaagaaactggt
gattatttagctatcgatatgggcggcactaatttcagagtcgcgttaattaaattaggt
ggtgatcatacttttgacactactcaatcaaaatataaattaccagatgaattgagaact
actcaacatccagaagaattatttgcatttttagctgattgtattgaatccttcttagaa
gaacaattcccagatggtgttactggtactttaccattaggtttcactttctcataccca
gcttctcaaaacaagattaacgagggtatcttacaaagatggactaaagggtttgatatt
ccaaatgtagaaggccatgatgtggttccaatgttgaagaaacaattagcaaagagaaag
ttacctgtcgatgttgttgctttgattaacgataccactggtactttagttgcttccttg
tattctgacccagataccaagatgggtgttattttcggtaccggtgtcaatggtgcttat
tatgatatggttaagaacattccaaagttggaaggaaagttagctgatgatattccagcc
aatgctccatttgccattaattgtgaatatggttcttttgataatgaacacgttgcttta
ccaagaactaaatatgatgttatggttgatgaacaatctccaagaccaggtcaacaaact
ttcgaaaagatgtcttctggttactacttaggtgaattattacgtttggttttagttgat
ctgcatgctcaaggctttatcttgaaggatcaagatttaactaaattaaacgtcccatac
tgtatggatacatcttatccatctagatttgaagatgatccatttgaaaatttggaaaat
gttgctgaaatctttgaaaaagacttcggtattaaaactacttctccagaaagaaaattg
atcagaaaattgtctgaagctattggtttaagatctgccagattatctgtttgtggtatt
gctgctatttgccaaaagatgggttatgaaactggtcatattgctgctgatggctctatc
ttcaaaatgtacccaggtttcccagaaaaggctgccttaggtttaaaggatatttatgga
tggaaagaaactgatccaaagaagatgcctttgagacttgtcgatgctgaagatggttcc
ggtgccggtgccgccatcattgctgctttagccgaaaaaagattggctgctggtaagtca
gttggtttaatcggtgcttaa

DBGET integrated database retrieval system