KEGG   Tetrapisispora blattae: TBLA_0I03540Help
Entry
TBLA_0I03540      CDS       T02489                                 

Gene name
TBLA0I03540
Definition
(RefSeq) hypothetical protein
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
tbl  Tetrapisispora blattae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TBLA_0I03540 (TBLA0I03540)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TBLA_0I03540 (TBLA0I03540)
   00051 Fructose and mannose metabolism
    TBLA_0I03540 (TBLA0I03540)
   00052 Galactose metabolism
    TBLA_0I03540 (TBLA0I03540)
   00500 Starch and sucrose metabolism
    TBLA_0I03540 (TBLA0I03540)
   00520 Amino sugar and nucleotide sugar metabolism
    TBLA_0I03540 (TBLA0I03540)
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    TBLA_0I03540 (TBLA0I03540)
Enzymes [BR:tbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     TBLA_0I03540 (TBLA0I03540)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:complement(847840..849300)
Genome map
AA seq 486 aa AA seqDB search
MVHLGPKKPPARKGSMIDVPEELIEQIHGLETIFRATPEKLQAVTKHFISELDKGLSKKG
GNIPMIPGWVVEYPTGKETGDYLAIDMGGTNFRVALIKLGGDHTFDTTQSKYKLPDELRT
TQHPEELFAFLADCIESFLEEQFPDGVTGTLPLGFTFSYPASQNKINEGILQRWTKGFDI
PNVEGHDVVPMLKKQLAKRKLPVDVVALINDTTGTLVASLYSDPDTKMGVIFGTGVNGAY
YDMVKNIPKLEGKLADDIPANAPFAINCEYGSFDNEHVALPRTKYDVMVDEQSPRPGQQT
FEKMSSGYYLGELLRLVLVDLHAQGFILKDQDLTKLNVPYCMDTSYPSRFEDDPFENLEN
VAEIFEKDFGIKTTSPERKLIRKLSEAIGLRSARLSVCGIAAICQKMGYETGHIAADGSI
FKMYPGFPEKAALGLKDIYGWKETDPKKMPLRLVDAEDGSGAGAAIIAALAEKRLAAGKS
VGLIGA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggttcatttgggtccaaagaaaccacctgcaagaaagggctctatgatcgatgtccca
gaagaattaattgaacaaattcatgggttagaaactattttcagggctactccagaaaaa
ttacaagctgtcactaagcatttcattagtgaattagataaagggttgtccaagaaaggt
ggtaacatcccaatgattccaggttgggttgttgaatatccaactggtaaagaaactggt
gattatttagctatcgatatgggcggcactaatttcagagtcgcgttaattaaattaggt
ggtgatcatacttttgacactactcaatcaaaatataaattaccagatgaattgagaact
actcaacatccagaagaattatttgcatttttagctgattgtattgaatccttcttagaa
gaacaattcccagatggtgttactggtactttaccattaggtttcactttctcataccca
gcttctcaaaacaagattaacgagggtatcttacaaagatggactaaagggtttgatatt
ccaaatgtagaaggccatgatgtggttccaatgttgaagaaacaattagcaaagagaaag
ttacctgtcgatgttgttgctttgattaacgataccactggtactttagttgcttccttg
tattctgacccagataccaagatgggtgttattttcggtaccggtgtcaatggtgcttat
tatgatatggttaagaacattccaaagttggaaggaaagttagctgatgatattccagcc
aatgctccatttgccattaattgtgaatatggttcttttgataatgaacacgttgcttta
ccaagaactaaatatgatgttatggttgatgaacaatctccaagaccaggtcaacaaact
ttcgaaaagatgtcttctggttactacttaggtgaattattacgtttggttttagttgat
ctgcatgctcaaggctttatcttgaaggatcaagatttaactaaattaaacgtcccatac
tgtatggatacatcttatccatctagatttgaagatgatccatttgaaaatttggaaaat
gttgctgaaatctttgaaaaagacttcggtattaaaactacttctccagaaagaaaattg
atcagaaaattgtctgaagctattggtttaagatctgccagattatctgtttgtggtatt
gctgctatttgccaaaagatgggttatgaaactggtcatattgctgctgatggctctatc
ttcaaaatgtacccaggtttcccagaaaaggctgccttaggtttaaaggatatttatgga
tggaaagaaactgatccaaagaagatgcctttgagacttgtcgatgctgaagatggttcc
ggtgccggtgccgccatcattgctgctttagccgaaaaaagattggctgctggtaagtca
gttggtttaatcggtgcttaa

DBGET integrated database retrieval system