KEGG   Tetrapisispora blattae: TBLA_0J00110Help
Entry
TBLA_0J00110      CDS       T02489                                 

Gene name
TBLA0J00110
Definition
hypothetical protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
tbl  Tetrapisispora blattae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tbl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:complement(5119..9720)
Genome map
AA seq 1533 aa AA seqDB search
MDLNRTLLLRLSDKGEPVTSNSYGQGVLTVPSLPPPPSDTPKGTPLFVVKLLISAGSPIA
RDGLVWTNCPPESTVEFERYTFYKHIIKTSFHKDDTIDLKIYKPGPYCFYLSFRNDAEEL
ETTRRFYFIVPPSLTINGKFLQLNSIAMQSVISKWLGNDINKDWNKIFQTISDKKYNMIH
FTPLQSRGESNSPYSIYDQLLFDPTHFNSLDDVIKMVNNLHENYNMLSLTDIVFNHTANN
SDWLRDHPDSGYNADTAPHLTAAIELDKALLDFSQNLGNLGYPVEINTNDDLLKILDGIK
IHVLGTLKLWEFYVVDVEQTINNVKSNWSKYDAQELIKDDTLDIHELQKDKNLSNFTIYL
KKHATMENFGKLGKRNSNQFDIAKLIGILKKLYGNDLNDEILNSTRKIFNDINLPFYKEY
DDDINEIMEQLYNRINYLKLDSNGLRQGPITLEKPLTEPYFTRFVATDGKEYALANNGWI
WNGNPMVDFASSDSKAYLRREVIVWGDCVKLRYGKSPKDSPYLWERITKYVEMNAKIFDG
FRIDNCHSTPLHVGEYFLDVARKVNPNLYVVAELFTGSESLDCFFVERLGISTLIREAMQ
AWSEEELSRLVHKHGGRPIGSFKYLPMDNMAYSPDLPIDEEYCTISKDNNYPRCVSEIMI
PKILTSAPPHALFMDCTHDNETPFQKRTVEDTLPNAALVSLCSSAIGSVYGYDEIYPYLL
NLVTETRNYLPNETNGIGKIKTILNNIREEINEESFDTEDSEMFVHHEGQYITFHRTNVK
KGSGWYLIARTKFYNGQGQKLAPIVLSQSTCKLLHAFTLEKVGDAIKDEKFLRGIPTILR
ELKDFKVTYDDESHSSTITMPEDFPQGSIAIFRTQQNKVEESLDHFVRTGAMKATENVTL
DSLNSLLYRCEAEEMDSSDGKEGAYDIPNFGKLKYCGLQGWITILKPIVFNNDLAHPLSE
NLRNGHWALDYTSERLNYYIDQPGIKESQEWLRGRFQRIKELPSYLVPSYFSLVVGVFYE
ACRFRAMQMFTKNIGNSTLFVQSLALTSVQMVSQMKYTSILPKENVPCMAAGLPHFSTGY
MRCWGRDVFISLRGLLLTTGRYEEAKSHILAFAKTLKHGLIPNLLDAGRNPRYNARDAAW
FFLQAIQDYVHIAPNGSDILKEKVTRRFPLDDTYIKLDDPRAFSYSTSIEDIIFEILQRH
AKGIKYREANAGHQIDRVMTDKGFDVEVNVDWETGLVHGGSQFNCGTWMDKMGESSKAGS
VGIPGTPRDGAAVEINGLLKSTLRFVIELHKEGKFQYSKVKKNDGSEISFQNWNDLLQNN
FEKKFYVPIESKDDAKFDVDPNIVNRRGMYKDLFRSGKPYEDYQLRPNFAIAMTVAPELF
TPEYALNAINLADKVIRGPVGMRTLDPNDYNYRPYYNNGEDSDNFATSKGRNYHQGPEWV
WCYGYFLRAFHHFNFMANPLSRNTEKDKPTSYLYQQLYNRLIEHRKWLRTSPWAGLAELT
NKDGEICNDSSSTQAWSSGCLLDLFYDLYDRYE
NT seq 4602 nt NT seq  +upstreamnt  +downstreamnt
atggacttgaacagaacgctgcttttaagactcagcgataagggtgaacctgtcacgtct
aattcgtatggtcaaggtgtcttgactgttccttcattacctcctcccccaagtgatact
cctaagggtactccactattcgtggtcaaattattgatctctgctggctctccaattgct
agagatgggttggtttggaccaattgtcctccagagagtacagtagagtttgaaagatat
acgttttataaacatattatcaaaacaagttttcataaggatgataccattgatttgaaa
atttataagccgggaccttattgtttctatttatcctttagaaatgatgctgaagaattg
gaaaccacaagaagattttatttcatcgtcccaccttctttaaccatcaatggtaaattt
ttacaattgaattctattgccatgcaaagtgtcatctcgaaatggttgggtaatgacatt
aataaagattggaataagatattccaaaccatctccgacaaaaagtataatatgattcat
ttcacacctttgcaatcaaggggagaatctaattctccttattccatttatgaccaatta
ctgttcgacccaactcatttcaattctttggacgatgttattaaaatggtaaataactta
catgaaaattataacatgttaagtcttactgatatagtttttaatcatactgcaaataat
tccgattggttaagagaccatcctgattcaggttataatgctgatactgctccacattta
actgctgctattgaattggataaggctcttctcgattttagtcaaaatttgggtaattta
gggtaccctgtcgagattaatactaatgatgatctattaaaaattttagatgggattaag
attcatgtcttgggcacgttgaagttatgggaattctatgtagttgatgtggaacaaact
attaataatgttaaaagtaattggtcgaaatacgatgctcaagaattaattaaagatgac
actttagatattcatgaattacaaaaagataaaaatttgtcaaacttcactatttatttg
aaaaaacatgctaccatggaaaattttggtaaactaggcaagagaaactccaaccagttc
gatattgcaaaattaattggtatattgaaaaaattatatggtaacgatctaaatgatgaa
atattgaatagtacaagaaaaatatttaatgacatcaatttacccttttataaagagtat
gatgatgatattaatgaaattatggaacaattatataatagaatcaattatttgaaatta
gattccaatgggttgagacaaggtcctattactttggaaaagcctttaacagaaccttat
ttcacaagatttgttgctacagatggtaaagagtatgcattggcaaataatggttggatt
tggaatggtaatcctatggttgattttgcatcttcagattcaaaagcttatttacgtaga
gaagtcattgtttggggcgattgtgtcaaattaagatatggtaaatctcccaaggattct
ccttacttatgggaaagaattaccaaatatgtagaaatgaacgcaaagatctttgatggg
ttccgtattgataactgccattctactccattacatgttggtgaatatttcctagatgtc
gcaagaaaagttaatccaaatttatatgtcgtcgctgaattatttactggttctgaatca
ttagattgtttctttgttgaaagattaggtatttctactttaattagagaagctatgcaa
gcttggtcagaagaagaattgtctcgtttagttcataaacatggcggtagaccaattggt
tctttcaagtatttaccgatggataacatggcctattctccagatttaccaatcgacgag
gaatattgtacaatttcaaaggataataattatccaagatgtgtctccgaaattatgatt
ccaaaaattttaacttctgctccacctcatgctttattcatggattgtactcatgataac
gaaactcctttccaaaagagaactgtagaagataccctaccaaatgctgcattggtttcc
ttatgttcttctgctattgggtctgtttatggttatgatgaaatctatccttatctttta
aatttggttactgaaactagaaattatttaccaaatgaaactaatggtattggtaaaatt
aaaacaattttaaacaatattagagaagagatcaatgaagaaagttttgataccgaagat
tctgaaatgtttgttcatcatgaaggtcaatacattactttccatcgtaccaatgttaaa
aagggttctggctggtatttaattgcaagaactaaattctacaatggtcaaggtcaaaaa
ttagctccgattgttttaagtcaatctacttgtaaattattacatgccttcactttagaa
aaagttggggatgcaattaaggatgagaaatttttaagaggtataccaacaattctaaga
gagttgaaagatttcaaagtcacatatgatgatgaatcgcattcttctaccattactatg
ccagaggatttcccacagggttctattgcaatctttagaactcaacaaaataaagtggaa
gaaagtttggatcattttgttagaactggtgctatgaaagctactgaaaatgtcactttg
gattctttaaattcattactttatcgttgcgaagctgaagaaatggattccagtgatggt
aaagagggtgcttatgatattccaaatttcggtaaattaaaatattgcggtttacaaggt
tggattactattttaaagccaattgtctttaacaatgacttagctcatcctttaagtgaa
aatttgagaaatggtcattgggctttagattatacttcagaaagattaaactattatatt
gatcaaccaggtattaaagaaagtcaagaatggttgcgtggtagatttcaaagaattaag
gaattaccaagttatttagttccaagttacttttccttagtagtgggtgttttctatgaa
gcctgccgttttagagctatgcaaatgtttactaaaaatattggtaattccaccttattt
gttcaaagtttagctttgacttccgttcaaatggtttctcaaatgaaatatacttcgatt
ttaccaaaggaaaatgtaccttgcatggctgcagggttacctcactttagtacaggttat
atgagatgttggggcagagatgtgtttatttccttaagagggttattattgactacagga
agatatgaggaggctaaatcccacattttggcctttgctaagactttgaaacatggttta
attccaaatttacttgatgcaggtagaaacccaagatataatgcccgtgatgcagcttgg
ttctttttacaagcaattcaagattatgttcatattgctccgaacggatcagacattttg
aaagaaaaagtaactagaagattcccattggatgacacttatattaaattagatgatcca
agagctttcagttattctacttctattgaagatattatttttgaaatattgcaaagacat
gctaaaggtattaaatacagagaagcaaatgcaggccatcaaattgaccgtgttatgaca
gataaggggtttgatgttgaagttaatgttgattgggaaacaggtcttgtccatggtgga
tctcaatttaattgtggtacttggatggataaaatgggtgaaagttccaaggctgggtca
gttggtataccagggacaccaagagacggtgcagctgtagaaattaatggtttattgaaa
agtactctaagatttgtcattgaattacataaagaaggaaaattccagtattcaaaagtt
aagaagaatgatggatctgaaatatcatttcaaaactggaatgatttattacaaaacaat
ttcgaaaagaaattttatgttccaatagaatctaaagatgatgctaagtttgatgttgat
cctaatatcgtgaacagaagaggcatgtataaagatttattccgttctggcaaaccgtat
gaagattatcagttgaggccaaattttgccattgcaatgacagtagcaccagaattattt
accccagaatatgcattaaacgctattaatctggctgataaagtaatcagaggtcccgtg
ggtatgagaactctggatccaaatgattataactatcgtccgtattataacaatggtgag
gattctgataattttgctacttcaaagggtagaaattatcatcaaggtcctgaatgggta
tggtgttatggctatttcttgcgtgctttccaccactttaatttcatggctaacccatta
agtcgtaatactgaaaaagataagccaacttcttatctttatcaacaactatataacagg
ttgattgaacatagaaaatggttacgtaccagtccatgggccggccttgctgaattaact
aataaagatggtgaaatatgtaacgattctagttcaacacaggcttggagttcgggctgt
ttactagatttgttttatgatttatatgatcgttacgaataa

DBGET integrated database retrieval system