KEGG   Tetrapisispora blattae: TBLA_0J00610Help
Entry
TBLA_0J00610      CDS       T02489                                 

Gene name
TBLA0J00610
Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tbl  Tetrapisispora blattae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TBLA_0J00610 (TBLA0J00610)
Enzymes [BR:tbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TBLA_0J00610 (TBLA0J00610)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:complement(133911..134933)
Genome map
AA seq 340 aa AA seqDB search
MGITVIGSLNYDLVTYTDLVPSSGETIRANKFETHPGGKGSNQCNSIAKLKSKNLDYKVK
MIGSVGNDSFGTQLVDLLKQNNVDVTDLAVLDNYQTGIATILVEEATGQNRILIAEGANG
QSVYTPTQLEKLFPQSLQSLQNDEQDEYIVFQHEIPDPCSIMKWLKENRSTYQIIYNPSP
FKKLSREQWLLSDILVVNEIEAMQIVESVYPKEEHTAYKLAIEKNFIEAYKTLCTDFQKK
LVNQQNSATVIITLGSRGVLFCSKNEPTVGYLPAVSGIKVVDTTGAGDTFLGGIVSQLYE
KKSLADAALFATTASSLAIQKRGAAESIPTHLQVLTTIKQ
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgggtattacagttatcggatctttaaattatgacctggtcacttatacagatcttgtt
ccatcatcaggtgaaaccattagagcaaacaagtttgagactcatccaggtggtaaaggt
tcaaaccaatgtaattcaattgcaaaattaaaatccaaaaatttggattataaagtaaaa
atgattggttcagtgggtaatgattcttttggtactcagttagttgatctcttaaagcaa
aataatgttgacgtgacagatttagcagtgttggacaattatcaaactggtattgccaca
attttagtagaagaagccacaggtcaaaatagaatcttgattgcagaaggtgctaatggt
caatctgtctataccccgacacaattagaaaaattgtttcctcagtcattacagtcatta
caaaacgatgaacaggatgaatatatcgtctttcaacatgaaatccctgatccttgttca
atcatgaaatggttgaaagaaaataggtcaacgtatcaaatcatttataatccttctcct
ttcaaaaaactatcaagggaacaatggttattatcagatattcttgttgttaatgaaatt
gaagctatgcaaattgttgaaagtgtatatccaaaggaagaacatactgcttataaatta
gcaattgaaaaaaattttattgaagcttataagacattgtgtacagattttcaaaagaag
ttggttaatcaacaaaatagtgccacagttattataactcttgggtcaaggggtgtctta
ttctgttcaaaaaatgaacctactgtaggctatttaccagctgtttctggaattaaagtt
gtagatactactggagctggggataccttcttaggtggtattgtaagtcaattatatgaa
aaaaaaagtttggcagatgctgccttgtttgcaacaacagcaagttctttagctattcaa
aaaagaggtgctgcagaaagtattccaacacatcttcaagtacttactacgataaagcaa
taa

DBGET integrated database retrieval system