KEGG   Tetrapisispora blattae: TBLA_0J01440Help
Entry
TBLA_0J01440      CDS       T02489                                 

Gene name
TBLA0J01440
Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
tbl  Tetrapisispora blattae
Brite
Enzymes [BR:tbl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     TBLA_0J01440 (TBLA0J01440)
    1.3.1.94  polyprenol reductase
     TBLA_0J01440 (TBLA0J01440)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:328211..328978
Genome map
AA seq 255 aa AA seqDB search
MIDLVTLLQYLIILYQLSLLLGFIALFTAKYFLPKFLQYGKTLQPIPSKKKQELSLLERI
SNFTVRKSYFAHFYIISAGFSFINITVFPTYSITWLILFHSVRRLYETLYISKYTKDSRM
NWSHYAVGIWFYTTLNLLTFHQLYTQRIVPHTINIFAFLVFSLASWDQYENHQTLSRLVK
YSLPRGRLFKIVACPHYLDEILIYLSLLSFSMIFIYPLLWVIVSLSISGIETKNYYRSKF
KPEKTQKYAILPYIL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgatagatttagtcacattattacaatatttaataattttataccaactttcgctatta
ttgggatttattgcattatttactgccaaatatttcctgccgaaatttttacaatatgga
aaaacgttacaaccaattccatcaaaaaaaaaacaagaattatctttattagaacgtata
tctaatttcacagttcgtaaatcatattttgctcatttttacatcatttcagcaggtttt
tcctttattaatataactgttttccccacatattcaataacatggttaattttatttcat
tcagtccgtagactgtatgaaacactttatatctcgaaatatactaaagattcaagaatg
aactggtcacattatgcagtcgggatttggttttatacaactttaaatcttttaactttc
catcaattatatactcagagaattgtacctcataccatcaatatatttgcatttttagtt
ttttcactagcatcatgggaccaatatgaaaaccatcaaacattatcaagattagtaaaa
tattctttaccaaggggtagattatttaagatagtagcatgcccacattatctcgatgaa
attttaatatatttatcgttactgtcatttagcatgatttttatttatccattactctgg
gttattgttagtctttcaatatcaggaattgagactaaaaactattatagatcaaaattc
aaaccagaaaagactcagaaatatgcaattttaccttatatcttatag

DBGET integrated database retrieval system