KEGG   Tetrapisispora blattae: TBLA_0J01690Help
Entry
TBLA_0J01690      CDS       T02489                                 

Gene name
TBLA0J01690
Definition
(RefSeq) hypothetical protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
tbl  Tetrapisispora blattae
Pathway
tbl00860  Porphyrin and chlorophyll metabolism
tbl01100  Metabolic pathways
tbl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TBLA_0J01690 (TBLA0J01690)
Enzymes [BR:tbl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     TBLA_0J01690 (TBLA0J01690)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     TBLA_0J01690 (TBLA0J01690)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Mqo Pyr_redox Thi4 DAO Pyr_redox_2 Lact-deh-memb
Motif
Other DBs
NCBI-GeneID: 14498345
NCBI-ProteinID: XP_004182682
UniProt: I2H9W1
Position
10:complement(373682..375202)
Genome map
AA seq 506 aa AA seqDB search
MSLQVPRNGKVCVIGSGVAGLTFSYLLNQLRPDVHIDIYEKQERSGGWLNSHHREVNGSK
VMLERGPRTLRGKSDGSIVMIDIMRRLGQLSQVQYVGKKSQANRQFLLNGQGRLVEVPKN
WTQFAKFVMDPISGGLVRGMAHDLLHCKRLDRKTYEDESVGQLLARRFGSTEIGDRIISG
IYHGIYAGDMNEMSSLHTGRRFVEDEMKYGSFVRGMFSGLGAKPSEILSGELMEYNRSIG
GQTQHNWTEFARRVKQSAMLGFAGGLEQYPLALRAYLEKQQQVRLRLGQAVASVLPGTGQ
NVVVNGVHYDHVRSTLNPSAMAAIFPEIQGLQHGDFKSVSVYIMNVYVPGTNLIRDAIAG
FGYLVPQRSSQGDGLLGVIFDSVVERNYLNWQTQLPRHQDDCTKMTLMVGGHYLNKGLHL
DLHKCLGHVSNHLGVDLAAYNPVTQNLLARDGIPVFDVGFDKKAARVVEECTRLYAGHVT
LGGVGFARGPGVPDVVMHELAAVLHA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttacaagttcctaggaatggaaaagtttgtgtgattggtagcggtgttgctggg
ttgacgttttcgtatctgttgaaccaattaagaccggatgttcatattgacatctatgag
aaacaggagcggagtggcgggtggctgaactcgcaccatcgcgaagtcaatggttccaaa
gtgatgttggagaggggtcctcggactttacgaggcaagagcgatggtagtattgtaatg
attgatattatgagacgattaggtcaattgagccaagtgcagtatgtaggaaagaagagc
caagcaaaccgtcaattcttgttaaatggacagggccgactagtggaagtgcccaagaat
tggacacaatttgccaagtttgtcatggacccgatcagtgggggattggttcgtggcatg
gcccatgatttgttgcattgtaagagactcgacaggaagacgtatgaggacgagagtgtg
ggacagttacttgcaagacggtttggcagtacagaaattggagaccggatcatcagcggg
atctatcacgggatctatgctggggacatgaacgagatgagtagtttacatacggggaga
cgttttgtggaagatgagatgaaatacggctcgtttgttagagggatgtttagtggtctg
ggagccaagccttccgaaattctgagtggggaattgatggagtataaccggtcgattggt
gggcaaacacaacacaactggacagagttcgcacgcagggtcaagcagagcgcaatgcta
gggtttgcgggcgggctggaacagtacccgctggcgctgcgtgcgtatcttgagaagcaa
cagcaggtacggctcagacttggccaggcggtggccagtgtgttgcccggcacagggcag
aacgtagtggttaacggggtccactacgaccacgtccgaagcacgctgaatcccagtgcg
atggcggctatcttcccagagatccaagggctgcaacacggtgatttcaagagcgtgagt
gtctacatcatgaacgtgtatgtaccgggaacgaacctcatacgagacgccattgcaggg
ttcgggtatctggttccacagcggtcgagccaaggagacggcctcctgggcgtgattttt
gactctgtcgtggagcgcaactatctaaactggcaaacacagctgcccagacaccaagac
gattgcaccaagatgacgttgatggtcgggggccattacttgaacaaaggattgcacctc
gacctgcacaaatgtctcggccatgtcagcaaccatctgggcgtggacctggcggcatac
aacccggtcactcagaacctgctggcacgtgacggcatccctgttttcgacgtgggcttc
gacaagaaagctgcacgggtggttgaggagtgcacgagattgtacgccgggcatgtgact
ctgggcggtgtcgggtttgccaggggcccaggtgtgccggacgtggtgatgcacgagctg
gccgcagtgctccacgcctaa

DBGET integrated database retrieval system