KEGG   Thermoanaerobacter brockii: Thebr_0147Help
Entry
Thebr_0147        CDS       T01409                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tbo  Thermoanaerobacter brockii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thebr_0147
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thebr_0147
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Thebr_0147
Enzymes [BR:tbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Thebr_0147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
148056..149111
Genome map
AA seq 351 aa AA seqDB search
MGWEGLIKAYREFMPKIKEENIVTLKEGNTPLYEAVNLQKLFPGIKIYLKYEGLNPTGSF
KDRGMTVAVSQAKEEGSNAVVCASTGNTSASAAAYAAKAGLKSIVLIPGGKIALGKLAQA
IAYGAKVIAIDGNFDDALRLVREISQKFPITLVNSINPYRLEGQKTASFEICDELKDAPS
YVALPVGNAGNITAYWMGFKEYYNAKRITRLPKMLGFQAAGAAPIVENRVIEKPETIATA
IRIGNPASWEKAVAARDESGGLIDKVTDEEILEAYALLAKSEGIFAEPASAASIAGVIKK
YKEGFFKEGESVVCVLTGNGLKDPDTAVKLGGEIKTIEANLKALEEVLYGE
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggatgggaaggtctaataaaagcatatagagaatttatgcctaaaataaaagaggaa
aacatagttacattaaaagaaggtaatacacctctttatgaggctgtaaatcttcaaaag
ctttttccaggcataaaaatatatctgaaatacgaaggattaaacccaacaggttctttt
aaagacaggggcatgactgtagcagtgtcgcaggcaaaagaagaaggttctaatgcagtt
gtgtgtgcttcaacaggaaatacttctgcttctgcagctgcctatgcagcaaaggcagga
cttaagagcattgtacttatacccggcggcaaaattgctttaggaaagcttgctcaagcc
attgcttatggtgctaaagtcattgctatagatggaaactttgatgatgctttaagatta
gtcagagaaatttcacaaaaattccctataacgctggttaattccataaatccatatagg
ttggaaggacaaaagacagcttcttttgaaatatgtgacgaacttaaagatgctccttct
tatgttgcgcttcctgtgggaaatgcggggaatataacagcctattggatgggatttaaa
gaatattataatgcaaaaagaataacgaggcttcctaaaatgttaggttttcaggcggct
ggagctgcacctatagttgaaaacagagtaattgaaaaacctgagactattgcaacagcg
atacgaataggtaatccagccagctgggaaaaggcagttgctgcaagagatgagtcaggt
ggactcattgacaaagtcacagatgaagaaatactggaggcttatgcgcttttagctaag
agcgaaggaatttttgcagagcctgcttcagcagcttctattgcaggagttattaagaaa
tacaaggaaggattttttaaagaaggagaatctgttgtttgtgtcttgacgggaaatgga
ttaaaagatccagatactgctgttaaattaggtggcgagataaaaacgatagaggcgaat
ctaaaagcattggaggaagttttatatggagagtga

DBGET integrated database retrieval system