KEGG   Thermoanaerobacter brockii: Thebr_0182Help
Entry
Thebr_0182        CDS       T01409                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo00900  Terpenoid backbone biosynthesis
tbo01100  Metabolic pathways
tbo01110  Biosynthesis of secondary metabolites
tbo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Thebr_0182
Enzymes [BR:tbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Thebr_0182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADV78810
JGI: Thebr_0182
UniProt: E8UTS8
Position
193268..194137
Genome map
AA seq 289 aa AA seqDB search
MKKIKVKAYAKINLSLDVLGKREDGYHEISTIMQSIDLADILEFEKSEIVKVFCNDHRVP
LGEDNLIVKVINLLKEKYQMEEGVLVKLDKRIPLAAGLAGGSADAAATIVALDKLWNLNM
SKEEKKEIALKVGADVPFCLEGGTKLAKGIGEIFEDLKITSMNLLLVKPDIEISTKEIYD
KWDRLNFKSHHATVPVVQAIQEGNIYKIAENIKNDLELVTSQKYGIINKIKEELLKKGAL
GCAMSGSGPTVYGIFDDLEKLRKAYEDLKEVYSFVFFSKTIDKGLELYE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcaaagtaaaggcctatgctaaaattaatttatctttagatgtattagga
aagagagaagatgggtatcatgaaatttctacaataatgcaatcaattgatttggctgat
attttagagtttgaaaaaagcgaaatagtcaaggttttttgcaatgaccatagagtacct
ttaggagaagataatttaatagtgaaggtcattaaccttctaaaagaaaaataccaaatg
gaagaaggggtgttagtcaagcttgacaagagaatccctttagctgccggccttgctggg
ggaagtgctgatgctgctgctacaattgttgcattagacaaattatggaatttaaatatg
tcaaaagaagaaaaaaaagaaattgctctgaaagtcggagcagatgttcctttctgtctg
gaaggtgggacaaagcttgcgaaaggcataggggaaatttttgaggatttaaaaattaca
tctatgaatttacttcttgtaaaacctgatattgaaatttccacaaaagaaatttatgat
aaatgggataggcttaattttaaaagtcatcatgctactgttccagtagtccaagctata
caagaaggaaacatatacaaaattgcagaaaatataaaaaatgatttagaattagtgact
tctcagaaatatggaattattaataaaataaaagaggaattgcttaaaaaaggcgcatta
ggatgtgctatgtcaggtagtggtcccactgtttatggaatttttgacgatttagaaaag
cttagaaaagcttatgaggatttaaaagaagtttacagttttgtgtttttttcaaaaact
atagataaggggttagaattgtatgaatga

DBGET integrated database retrieval system