KEGG   Thermoanaerobacter brockii: Thebr_0212Help
Entry
Thebr_0212        CDS       T01409                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
tbo  Thermoanaerobacter brockii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Thebr_0212
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thebr_0212
   00620 Pyruvate metabolism
    Thebr_0212
   00650 Butanoate metabolism
    Thebr_0212
  Lipid metabolism
   00071 Fatty acid degradation
    Thebr_0212
  Amino acid metabolism
   00350 Tyrosine metabolism
    Thebr_0212
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Thebr_0212
   00626 Naphthalene degradation
    Thebr_0212
Enzymes [BR:tbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Thebr_0212
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Thebr_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(226344..228962)
Genome map
AA seq 872 aa AA seqDB search
MPTLLQEKKETKEKTEVKETTDVKKQIDLLVERAKRAQEKFMSYTQEQINEIVKAMALAG
IEKHVELAKLAHEETKMGVYEDKITKNLFAVEYVYNYIKDKKTVGILKENLEENYMEVAE
PVGVIAGVTPVTNPTSTTMFKCLIAIKTRNPIIFSFHPKALKCSIEAAKTMYEAALKAGA
PEGCIGWIETPSIEATQLLMTHPDISLILATGGAGMVKAAYSSGKPALGVGPGNVPCYIE
KTANIKRAVSDLILSKTFDNGTVCASEQAVIIDEEIADEVKKLMKEYGCYFLNKEETKML
EEFAIDKNTGLMNPAVVGQPATKIAEMAGFKVPENTKILVAEYPAVGPEYPLSREKLSPI
LALYTVKDYNEGIKRCEDMTEFGGLGHSAVIHSENQQIINEFAKRVRAGRILVNAPASQG
AIGDIYNTAIPSLTLGCGTMGRNSTTDNVSVYNLINIKRVFIRKERMKWFRVPPQIYFER
GSLQYLSQVKGKKAFIVTDPVMVKLGFVDKVTYQLDKANIKYEIFSEVEPDPSVDTVEKG
VKIMRGFEPDLLIAVGGGSAIDAAKGMWLFYEYPDTKFEDLRLKFMDIRKRTYRFPELGK
KALFIAIPTTSGTGSEVTAFAVITDKKKNIKYPLTDYELTPDIAIIDPDLTMTIPPSVTA
DTGMDALTHAIEAYVSVMASDYTDALAEKAIKLIFEYLPKAYKNGQDKVAREKMHNASCI
AGMAFTNAFLGINHSMAHILGAKFHLPHGRANAILLPYVIEYNAELPKKFAAFPQYEYPK
AAEKYAEIAKMLGLPASTVEEGVQSLIEAIKNLMKELNLPLTLKEAGINKEEFEKQIMEM
SDIAFNDQCTGSNPRMPLVSEIAEIYRKAYGE
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccttattacaagaaaaaaaggaaacaaaagaaaaaacagaagtaaaagaaaca
acagatgttaaaaagcagatagacctattagtagaaagagcgaaaagagcacaagaaaaa
ttcatgtcatacacccaagagcaaattaatgaaatagtcaaagccatggcactagcaggc
atagaaaagcatgtagaactggcaaaattagctcatgaagagacgaaaatgggggtttat
gaagacaaaataaccaaaaacctttttgcagtagaatatgtgtacaattatataaaagac
aaaaaaactgtcggcatcctcaaagaaaacttagaagaaaattatatggaagtggcagaa
cctgtaggagttatagccggcgtaacacctgtcacaaacccgacttctacaacaatgttc
aaatgcctcattgctatcaaaacaagaaatccaataattttcagcttccacccaaaagca
ttaaaatgtagtatagaagcagcaaagacgatgtacgaggcagcattaaaggctggtgca
ccagaaggatgtataggatggattgagacaccctcaattgaagcaacacaacttctcatg
acacatcccgatatatctcttatcctagcaacaggcggcgccggaatggtaaaagctgct
tacagctcaggaaaacccgcccttggcgtaggtcctggcaatgtcccctgctacattgaa
aaaactgcaaatattaaaagagcagtctcagacctaatacttagcaaaacttttgacaat
ggcacagtatgcgcatcagaacaagctgtgataatagacgaagaaatagcagatgaagtg
aaaaaattaatgaaagaatatggttgctattttctcaataaagaagagactaaaatgcta
gaagaattcgctatagacaaaaacaccggtttaatgaatccagcagttgtaggtcaaccg
gcaacaaaaattgctgaaatggctggatttaaagtacctgaaaacacaaaaatacttgta
gctgaatatcctgctgtaggaccagaatatcctctctccagagaaaagctaagtccaata
cttgctttatacacagtcaaagattacaacgaaggcataaaaagatgtgaagatatgaca
gaattcggcggacttggtcactctgcagtaatacattctgaaaaccaacaaattattaat
gaatttgcaaaaagagtacgagcaggaagaattcttgtaaacgcccctgcttctcaagga
gctattggagatatttataacacggctatcccatctttgactttgggttgcggtacaatg
ggtagaaattcaacaacagataatgtaagtgtttataaccttataaacataaaacgagtt
tttataagaaaagagagaatgaaatggttcagagttccaccacaaatttattttgaaaga
gggtcattacaatatctgtcacaagtaaaaggcaaaaaagcctttattgtaacagaccct
gtgatggttaaattaggttttgtagataaagtaacgtatcaattagataaggcaaatatt
aaatatgaaatattctctgaagttgaaccagatccttcagttgacactgtagaaaaaggg
gtaaaaataatgagagggtttgagcctgacttactaatagctgtaggtggtggttctgca
atagatgcagcgaagggaatgtggcttttctacgaataccctgatacaaaattcgaagac
ttaaggttaaaatttatggacataagaaaaagaacttatagatttcctgaactggggaaa
aaagctttatttatcgcaataccaaccaccagcggtacaggttctgaagttactgccttt
gcagttataacagacaaaaagaaaaatataaagtaccctctcacagattacgaattaaca
ccagatatcgctataatagaccctgacctcacaatgacaataccaccctctgtcacagca
gacactggtatggacgctttaacccatgctattgaagcctatgtatctgtaatggcatca
gactatacagacgctctcgcagaaaaagctataaaattgatatttgaatatctacctaaa
gcatacaaaaacgggcaagataaagtcgcccgcgaaaagatgcacaatgcttcatgcata
gctggaatggccttcacaaatgcatttttaggaataaaccatagtatggctcatatactt
ggtgctaaattccatcttccacacggaagagcaaatgcaatacttctgccctatgtcata
gaatacaatgcagaactccccaagaaatttgcagcattcccgcaatatgaatatccaaaa
gcagccgaaaaatatgcagaaattgcaaaaatgttaggacttcctgcatcaaccgttgaa
gaaggagtacaaagcctcattgaagcgataaaaaatctcatgaaagaacttaatcttcct
ttgacacttaaagaagcaggcataaataaagaagaattcgaaaaacaaataatggaaatg
tcggatatagcctttaatgaccagtgcactggctcaaatccaagaatgccattggtatcc
gaaattgcagaaatttacagaaaagcctatggagaataa

DBGET integrated database retrieval system