KEGG   Thermoanaerobacter brockii: Thebr_0222Help
Entry
Thebr_0222        CDS       T01409                                 

Definition
glutamate synthase
Orthology
K00266  
glutamate synthase (NADPH/NADH) small chain [EC:1.4.1.13 1.4.1.14]
Organism
tbo  Thermoanaerobacter brockii
Pathway
Alanine, aspartate and glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thebr_0222
  Energy metabolism
   00910 Nitrogen metabolism
    Thebr_0222
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Thebr_0222
Enzymes [BR:tbo01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     Thebr_0222
    1.4.1.14  glutamate synthase (NADH)
     Thebr_0222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(241681..243081)
Genome map
AA seq 466 aa AA seqDB search
MPLNRSKKKTPMPTQKPEVRRRNFNEVALGYSEEEAVSEAQRCLQCKKPGCVEGCPVQVQ
IPQFIKRIAERDFEGAIKIIKETNSLPAICGRVCPQETQCEKNCVLGKVGEPVAIGRLER
FAADWERAKGIRPPVIPKKLGKKVAIIGSGPAGLTCAGDLAKLGYDVTIFEALHKPGGVL
VYGIPEFRLPKIIVEQEVKFIQQLGVEIKTNMVMGKVLTIDDLFEMGYEAVFIGTGAGLP
KFMGIPGENYLGVYSANEFLTRINLMKAYSFPNTDTPIKVGKKVAVIGGGNVAMDAARSA
LRMGADEVHIVYRRSEEEMPARKEEFENAKEEGIIFDFLTNPVRIIGNENGWVKGIECIR
MELGEPDASGRRRPVPITGSEFIMDVNTVVIAIGTGPNPLLTKTTEGLELTKHGYIAVDE
EGRTSREGVWAGGDIVTGSATVILAMGAGKKAARSIHEYLQNKKWR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgccgttaaatagaagcaaaaagaaaacacccatgcctacccaaaagcctgaagtccgc
aggcgtaattttaacgaagtagctttgggctattcggaagaggaggcagtaagtgaagcc
cagaggtgtcttcagtgtaaaaaaccaggatgtgttgaagggtgccccgttcaggtacaa
attccccagtttataaagcgtattgcagaaagagattttgaaggagctataaagattata
aaggaaaccaacagcttgcccgccatatgtggcagagtctgtccacaagaaacgcaatgc
gagaaaaactgtgttttgggcaaagtaggtgaacctgtggccataggtcgcctagaacgg
tttgcagcagactgggaaagagccaaaggcatccgtcccccggtaattcctaaaaagctt
ggtaaaaaagtggccatcatcggttccgggcccgccggtctcacctgtgcaggagatttg
gctaaactcggctacgatgtaacgatctttgaagctcttcacaaacccggtggcgtactg
gtatacggtattcctgaattcaggctaccgaaaattatagtggaacaagaagtaaagttt
atacaacagctgggcgtagaaattaaaaccaacatggttatgggcaaagttctgacgata
gacgacctttttgaaatggggtatgaggctgtctttatcggcactggagctggcctcccg
aaatttatgggcatacctggtgaaaactacctgggtgtgtattcagccaacgagtttcta
accaggataaacctgatgaaagcctattcttttcccaacactgacacccccataaaggta
ggcaaaaaagtagcagtaatagggggtggcaatgtagctatggatgcagccaggtctgct
ctaagaatgggagctgacgaagttcatattgtgtatcgccgttctgaagaagaaatgccc
gcaagaaaagaagaattcgagaacgctaaagaggaaggtattatatttgatttcctcaca
aatccagtgagaataataggtaacgaaaatggttgggtcaaaggtattgagtgtatccgc
atggaacttggagaacctgacgcttcgggtcgtcgccgtccagttcctataacgggttct
gaatttatcatggatgttaatacggtagtaatcgccataggtactggccctaatcccctc
ctcacaaagaccactgaaggcttagaacttacaaaacacggttatatcgctgtcgatgag
gagggaaggacttccagagaaggggtatgggctggaggcgatattgtaacgggttcagct
actgtaattttggccatgggtgccggaaaaaaagcagctcgctccatccatgaataccta
caaaacaaaaaatggcggtaa

DBGET integrated database retrieval system