KEGG   Thermoanaerobacter brockii: Thebr_0222Help
Entry
Thebr_0222        CDS       T01409                                 

Definition
glutamate synthase
Orthology
K00266  
glutamate synthase (NADPH/NADH) small chain [EC:1.4.1.13 1.4.1.14]
Organism
tbo  Thermoanaerobacter brockii
Pathway
Alanine, aspartate and glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tbo01230]
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:tbo00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tbo00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(241681..243081)
Genome map
AA seq 466 aa AA seqDB search
MPLNRSKKKTPMPTQKPEVRRRNFNEVALGYSEEEAVSEAQRCLQCKKPGCVEGCPVQVQ
IPQFIKRIAERDFEGAIKIIKETNSLPAICGRVCPQETQCEKNCVLGKVGEPVAIGRLER
FAADWERAKGIRPPVIPKKLGKKVAIIGSGPAGLTCAGDLAKLGYDVTIFEALHKPGGVL
VYGIPEFRLPKIIVEQEVKFIQQLGVEIKTNMVMGKVLTIDDLFEMGYEAVFIGTGAGLP
KFMGIPGENYLGVYSANEFLTRINLMKAYSFPNTDTPIKVGKKVAVIGGGNVAMDAARSA
LRMGADEVHIVYRRSEEEMPARKEEFENAKEEGIIFDFLTNPVRIIGNENGWVKGIECIR
MELGEPDASGRRRPVPITGSEFIMDVNTVVIAIGTGPNPLLTKTTEGLELTKHGYIAVDE
EGRTSREGVWAGGDIVTGSATVILAMGAGKKAARSIHEYLQNKKWR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgccgttaaatagaagcaaaaagaaaacacccatgcctacccaaaagcctgaagtccgc
aggcgtaattttaacgaagtagctttgggctattcggaagaggaggcagtaagtgaagcc
cagaggtgtcttcagtgtaaaaaaccaggatgtgttgaagggtgccccgttcaggtacaa
attccccagtttataaagcgtattgcagaaagagattttgaaggagctataaagattata
aaggaaaccaacagcttgcccgccatatgtggcagagtctgtccacaagaaacgcaatgc
gagaaaaactgtgttttgggcaaagtaggtgaacctgtggccataggtcgcctagaacgg
tttgcagcagactgggaaagagccaaaggcatccgtcccccggtaattcctaaaaagctt
ggtaaaaaagtggccatcatcggttccgggcccgccggtctcacctgtgcaggagatttg
gctaaactcggctacgatgtaacgatctttgaagctcttcacaaacccggtggcgtactg
gtatacggtattcctgaattcaggctaccgaaaattatagtggaacaagaagtaaagttt
atacaacagctgggcgtagaaattaaaaccaacatggttatgggcaaagttctgacgata
gacgacctttttgaaatggggtatgaggctgtctttatcggcactggagctggcctcccg
aaatttatgggcatacctggtgaaaactacctgggtgtgtattcagccaacgagtttcta
accaggataaacctgatgaaagcctattcttttcccaacactgacacccccataaaggta
ggcaaaaaagtagcagtaatagggggtggcaatgtagctatggatgcagccaggtctgct
ctaagaatgggagctgacgaagttcatattgtgtatcgccgttctgaagaagaaatgccc
gcaagaaaagaagaattcgagaacgctaaagaggaaggtattatatttgatttcctcaca
aatccagtgagaataataggtaacgaaaatggttgggtcaaaggtattgagtgtatccgc
atggaacttggagaacctgacgcttcgggtcgtcgccgtccagttcctataacgggttct
gaatttatcatggatgttaatacggtagtaatcgccataggtactggccctaatcccctc
ctcacaaagaccactgaaggcttagaacttacaaaacacggttatatcgctgtcgatgag
gagggaaggacttccagagaaggggtatgggctggaggcgatattgtaacgggttcagct
actgtaattttggccatgggtgccggaaaaaaagcagctcgctccatccatgaataccta
caaaacaaaaaatggcggtaa

DBGET integrated database retrieval system