KEGG   Thermoanaerobacter brockii: Thebr_0239Help
Entry
Thebr_0239        CDS       T01409                                 

Definition
phosphoglycerate mutase 1 family
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tbo  Thermoanaerobacter brockii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thebr_0239
   01230 Biosynthesis of amino acids
    Thebr_0239
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thebr_0239
  Energy metabolism
   00680 Methane metabolism
    Thebr_0239
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thebr_0239
Enzymes [BR:tbo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Thebr_0239
Exosome [BR:tbo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Thebr_0239
  Exosomal proteins of melanoma cells
   Thebr_0239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
266549..267304
Genome map
AA seq 251 aa AA seqDB search
MHKVVLLRHGESLWNMENRFTGWTDVDLSPKGIEEARESGKTLKAEGYTFDCAFTSVLKR
AIRTLWIVLDELDRMWIPVYKSWRLNERHYGALQGLNKAETAKKYGEEQVKIWRRSVDVR
PPALEKDDPRYPGFDPRYADLSEEEIPLTENLIDTINRVIPYWESTIAPTIKSGKKVLIV
AHGNSLRGLVKYLDNLSKQEIMELNIPTGIPLVYELDDDLKPIRHYYLADEEKVKEKKEL
VENQGKIQGNS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcataaagttgttttgctaagacatggagaaagcctgtggaatatggaaaacagattt
actggctggacggatgttgatttatctccaaagggcattgaagaagctcgggaaagcggc
aagactttaaaggcagaagggtacacttttgactgtgcttttacttctgttttaaaaaga
gctataagaactttgtggattgttcttgacgaattagacaggatgtggataccggtttat
aaatcatggaggctcaatgaaaggcattatggagcactgcaagggcttaataaagctgag
accgccaagaaatacggagaagagcaggtaaaaatatggagaagatctgttgatgtaagg
cctcccgccttagaaaaagatgacccgagatatcccggttttgaccccagatatgctgac
ctttctgaggaagaaatcccccttactgaaaatttgattgatacaattaacagagttatt
ccatattgggagtccacaattgcaccgactataaaatcaggtaaaaaagtgctaatagtt
gctcatggaaatagtttgagagggcttgtaaaataccttgacaatctttctaagcaggag
ataatggagttaaatattcctacaggaattccgttagtttatgagcttgacgatgattta
aaacctataaggcattattatcttgccgatgaagagaaagtaaaagagaagaaagaatta
gtagaaaaccaaggaaagattcaagggaattcttaa

DBGET integrated database retrieval system