KEGG   Thermoanaerobacter brockii: Thebr_0329Help
Entry
Thebr_0329        CDS       T01409                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tbo  Thermoanaerobacter brockii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tbo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
355535..356101
Genome map
AA seq 188 aa AA seqDB search
MIDKEKIKKAVRDILEAIGEDPDREGLLETPDRVARMYEEIFAGLHTDVKDVIKIFQEDE
HQEIILVKDIPLYSMCEHHLLPFIGVAHVAYLPRKGRILGLSKLARIVDILAKRPQLQER
LTSEIADTIMEAVNPLGVAVVIEAEHLCMTMRGIKKPGAKTVTSALRGIFRTDEKSRAEV
MSLINSKK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgatagataaagaaaagattaaaaaagcggtaagagacatacttgaagccataggagaa
gacccggatagggaggggctccttgagactcctgatagggttgcaaggatgtatgaggaa
atttttgctggccttcatacggatgtaaaagacgttataaagatttttcaggaggatgaa
catcaagaaataatacttgtaaaagatattccgctttattctatgtgcgaacatcatctc
ttgccttttataggagttgcccatgtagcgtatttgcctagaaaaggtagaattttaggc
ctttcaaaattagctcgcatagtagatattttagcaaaaaggccacagcttcaagagagg
ttgacaagtgaaattgcagataccataatggaagcagtgaatcccttaggtgttgccgtt
gtcattgaggcagaacatttgtgtatgacaatgagaggtatcaaaaagccgggggccaag
actgttacttctgctttgagaggaatatttagaacagatgaaaaatcaagggcagaggta
atgtctttaataaattctaaaaaataa

DBGET integrated database retrieval system