KEGG   Thermoanaerobacter brockii: Thebr_0330Help
Entry
Thebr_0330        CDS       T01409                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
tbo  Thermoanaerobacter brockii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Thebr_0330
Enzymes [BR:tbo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Thebr_0330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
356114..356926
Genome map
AA seq 270 aa AA seqDB search
MLFRCRDKSLEIGKKTYIMGILNMTPDSFSDGGKYNTLEKGIERALQMIEEGADIIDVGG
ESTRPGHTPVDEEEEMRRVIPVIEKLSKISNVIISVDTMKSNVALRALEAGAHIVNDVWG
LQRDPKMAEVVAKYNAGVIMMHNSNVAEYEDVVQDIIKFLQKSIEIGEKAGIDKSQMVVD
PGIGFGKTLDHNLEVMNRLEELKVLGLPVLLGTSRKSMIGKVLNLEVEDRLEGTAATVAV
GIVKGVDIVRVHDVKQMLRVAKMTDAMVRR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgctatttaggtgcagagataaaagtctggagattggaaaaaaaacttacataatggga
attttaaatatgactcctgattctttttcagatgggggaaaatataatactttagaaaaa
ggcatagaaagagctcttcaaatgatagaagaaggagctgacataatagatgtaggtgga
gagtctacaaggccgggacatactccagtggatgaagaagaagaaatgagaagagttata
cctgtcattgaaaagctttcaaaaatttcaaatgtcattatatctgtggatactatgaaa
tcaaatgtggcattaagagctttagaagcaggtgctcacatagtaaatgatgtatgggga
cttcaaagggaccccaaaatggcggaagtagttgcaaaatacaatgcaggtgtaataatg
atgcataacagcaatgtagcagaatatgaagatgttgttcaggatataataaaattttta
caaaaaagcatagagataggagaaaaagcaggaattgataaaagtcaaatggtagtggac
ccagggataggttttggaaaaactttagatcataatcttgaggtcatgaatcgattggaa
gaattaaaagttttaggacttcctgtgcttttaggtacttctaggaaatccatgattgga
aaagttttaaaccttgaagtagaggatagattggaagggactgctgcaacagttgctgtt
gggattgtaaaaggggttgatattgtacgcgttcacgatgtaaagcagatgttaagagtt
gctaagatgactgatgcgatggtgagaagatga

  All links  
No link information was found.   
DBGET integrated database retrieval system