KEGG   Thermoanaerobacter brockii: Thebr_0507Help
Entry
Thebr_0507        CDS       T01409                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tbo  Thermoanaerobacter brockii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thebr_0507
   01230 Biosynthesis of amino acids
    Thebr_0507
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thebr_0507
   00030 Pentose phosphate pathway
    Thebr_0507
   00051 Fructose and mannose metabolism
    Thebr_0507
   00052 Galactose metabolism
    Thebr_0507
  Energy metabolism
   00680 Methane metabolism
    Thebr_0507
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Thebr_0507
Enzymes [BR:tbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Thebr_0507
Protein phosphatases and associated proteins [BR:tbo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Thebr_0507
Messenger RNA biogenesis [BR:tbo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Thebr_0507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
513171..514415
Genome map
AA seq 414 aa AA seqDB search
MYTKSNCLIAQSGGPTAVINSSLYGAIMEASRSEKIDKVYGGINGIEGIIKGNIIDIFDI
PYERIKQMRFSPAAALGSCRYRLKDYLEDEEEYKKLIEIFKKYNIKYFFYIGGNDSMDAV
DKISKYAREIGFEINVIGIPKTIDNDLMFTDHSPGFGSAAKYIATTTLELALDAEVYETK
TINVLEVMGRNAGWLTASSALVKERLPHLKQLIYLPEIPFNEERFLEDVNKAYKEYGNVF
ITVSEGLMDEKGNYIGRKENAYHKDAFGHPQLGGVGDYIEKLVKEKIYKRVKMTRLGVTQ
RCAMHLASKVDFEEAEMLGKEAVKYALFGETGKMISLVRERNYPYTVKTDIVDVDKVCNK
EKKMPLNWINEEGNYVTEEFFDYARPLIQGEVKVPMAEGLPYYINLKYAIKKQE
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtatactaaaagcaattgtcttatagcacaatcgggtggtcctacagctgttattaac
tccagtctgtatggagctataatggaagcttcacgctcagagaaaattgataaagtttat
ggtgggataaacggcatagaaggtataataaaaggcaatattattgacatatttgatatt
ccctatgaaagaataaaacaaatgagatttagccctgcggctgcattagggtcgtgccga
tataggctaaaagactatttagaggatgaagaggaatacaaaaagttaatagaaattttt
aagaaatacaacattaaatattttttctacataggtggcaatgattctatggatgccgtt
gacaaaatcagtaaatatgcaagagaaataggttttgaaataaatgtaattggaattcct
aagactattgataacgatttgatgtttacagatcattctcctggttttggaagtgcggca
aaatatatagccacaactactttagaacttgctttagatgcggaagtgtatgagactaaa
acaattaacgtactcgaagtgatgggcagaaatgcaggttggcttaccgcttcttctgct
ttggttaaagaaagattgccccatttgaaacaacttatttatcttcctgagatacctttt
aatgaggaaagatttttagaggatgtaaataaagcttataaggaatatggcaatgtcttt
ataactgtatcagaaggacttatggatgaaaaagggaattacattggaagaaaagaaaat
gcttatcataaagatgcttttggtcatcctcaactgggaggagtaggagactatatagaa
aagcttgtaaaagagaaaatatataaacgtgtcaaaatgaccagacttggtgtaacgcaa
agatgtgcaatgcacttggcatctaaagtggattttgaagaagctgagatgttggggaag
gaagcagtaaagtatgcgttatttggtgaaaccgggaaaatgataagtcttgtaagagaa
agaaattacccatacactgttaaaacggatattgtagatgttgataaagtgtgtaacaag
gagaaaaaaatgcctttaaattggataaatgaagaaggtaattatgttactgaagaattt
tttgattatgcaagaccacttatacaaggagaagtgaaggtccctatggcagaagggtta
ccttattatataaacttaaaatatgcgataaaaaagcaggaataa

DBGET integrated database retrieval system