KEGG   Thermoanaerobacter brockii: Thebr_0531Help
Entry
Thebr_0531        CDS       T01409                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo00340  Histidine metabolism
tbo01100  Metabolic pathways
tbo01110  Biosynthesis of secondary metabolites
tbo01230  Biosynthesis of amino acids
Module
tbo_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Thebr_0531
Enzymes [BR:tbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Thebr_0531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh HOIP-UBA
Motif
Other DBs
NCBI-ProteinID: ADV79134
JGI: Thebr_0531
UniProt: E8UVQ3
Position
543970..545253
Genome map
AA seq 427 aa AA seqDB search
MIEIFDFRKGIDNGILQKLHNRSKLENKEIAKKVEEIISNVRERKDKALFEYTYMFDGIN
LDKSTVKVTKEEIKNAYKEVEGEFLKAIDKAIKNITEFHEKQKQSTWMDFKEGIVYGQII
RPLSQVGIYVPGGTASYPSSVLMNGIPAKVAGVEKIVMVSPAGKKGVNPYVLVAADKIGI
EDIYKVGGAQAVAALAFGTESIPKVDKIVGPGNIFVALAKRALYGHVDIDMVAGPSEVLV
IADETANPKYVAADLLSQAEHDVMASSILVTTSLEVAQQVKIEIERQMEYLERKEIIEKS
LKNFGAIIVVNNLKEAIGIANDIAPEHLELNISNAFEIIGEIKNAGAVFVGEYSPEPLGD
YLAGPNHVLPTSGTARFFSPLSVTDFIKKMNILYYSKDSLREVKEDVITLANSEGLTAHA
NSIKVRF
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgattgagatatttgattttcgaaagggaattgacaatggtattttacaaaagcttcac
aacagaagtaaattagagaataaagaaatagcaaaaaaagtggaagaaataatttcaaac
gtaagagagagaaaagacaaggctttgtttgagtatacttacatgtttgacggaataaat
cttgacaaaagtactgtaaaagttacgaaagaggaaataaaaaatgcttataaagaagtg
gaaggagaatttttaaaagcgattgacaaagctatcaaaaacataacagaatttcatgaa
aagcaaaaacagtctacatggatggattttaaagaaggtatagtttatgggcaaataata
aggcccctttctcaagttggaatttatgtgccggggggaaccgcttcttatccttcttca
gttttgatgaatggaatacctgcaaaggtggctggtgtagagaaaatagtgatggtttct
ccggctggtaagaagggagtaaacccttatgtgttagtggctgcagacaagataggaata
gaggatatatataaagttggaggcgcacaggctgttgcagccttggcatttgggacagag
tcaatacctaaggttgataaaatagttggcccgggaaatatttttgtcgcactggctaaa
agagctctttacggacatgtggatattgatatggtggcaggccccagtgaagttttagtt
atagctgacgaaactgctaatcctaaatatgtggcggcggacctgttgtcacaggcggaa
catgatgtaatggcatcttcaatacttgtcacaacatctttggaggttgcgcaacaagta
aaaatagaaattgaaaggcaaatggaatatcttgaaaggaaagaaataattgaaaagtct
ttaaaaaattttggtgcgataattgttgtaaataatttaaaagaagcaattggtattgca
aatgacatagctccggagcatttagagcttaacatttccaatgcctttgaaataattggt
gaaatcaagaatgcaggagcagtctttgtgggagaatattctccagaacccttaggggac
tatcttgctggccctaaccatgtgcttcctactagtggaacagcaaggtttttctcgcct
ctttctgtgacggactttatcaaaaagatgaatattctctattattctaaggattctttg
agagaggtaaaagaggatgtaataactttagcaaattcagaagggcttaccgctcatgct
aattctataaaagtgaggttttaa

DBGET integrated database retrieval system