KEGG   Thermoanaerobacter brockii: Thebr_0551Help
Entry
Thebr_0551        CDS       T01409                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tbo  Thermoanaerobacter brockii
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tbo00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
563919..565412
Genome map
AA seq 497 aa AA seqDB search
MAKYIMAFDQGTTSSRAIIFDRSGKIIASLNQEFKQIYPKAGWVEHDPMEIWGTQIGVAK
GVIEKAGINPEDIAAIGITNQRETTVVWDKNTGKPIYNAIVWQCRRTAPICDELKNKGFD
KKIREKTGLVVDAYFSGTKIKWILDNVEGAREKAEKGELLFGNIDTWLIWNLTRGKVHVT
DYSNASRTMIFNIHELKWDKEILAELNIPEQMLPEVKPSSYVYGYTDKSIFGVEIPIAGD
AGDQQAALFGQACFKPGMAKNTYGTGCFMLMNTGEKAVPSNTGLLTTIAWGIDGKVEYAL
EGSIFIAGAAIQWLRDELRIIDNSPQSEEYAMKVEDTNGVYVVPAFVGLGAPYWDMYARG
TIVGLTRGAKREHIIRATLESIAYQTRDVLEAMQEDSGIRLQALKVDGGASANNFLMQFQ
SDILGVPVDRPQVIETTALGASYLAGLAVGFWNSREEIEKNWNVDKHFEPAMDNEKREKL
YKGWKKAVERAMKWAEE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtacattatggcttttgaccaggggacaacaagttcccgtgcgataattttt
gaccgcagcgggaaaataatagcttcactaaaccaggaatttaagcaaatttatcctaag
gcaggttgggtagaacatgatccaatggagatatggggtacacaaataggtgttgcaaaa
ggtgttatagaaaaagcgggtattaatccggaggatattgcagctattggcattacaaat
cagagagagacaactgttgtgtgggataaaaatacaggaaaacctatttacaatgcaata
gtatggcaatgcaggaggactgctcctatatgcgatgaactaaaaaataaaggttttgac
aagaaaattagagaaaaaaccggacttgtagtagatgcatatttttctggtactaaaata
aaatggattttggataatgttgaaggagcaagagaaaaagcagaaaaaggagaattgctt
tttggaaatattgatacatggcttatttggaatttgacaagaggtaaggtacacgtaacc
gactattccaatgcttcaaggacgatgatctttaacatacatgagcttaaatgggataaa
gagatattggctgaacttaacataccagagcaaatgcttccggaagttaagccttccagt
tatgtatatggctatactgataaaagtatatttggagtagagatacctattgccggagat
gcgggagaccagcaggcagctttgtttggtcaagcttgttttaaacctgggatggcaaaa
aacacctatggaacaggctgctttatgcttatgaatacaggggaaaaggccgtgccttca
aatactggacttctcactacaatcgcttggggaattgatggaaaagtagaatatgcctta
gagggtagtatatttatagcaggtgctgcgatacagtggttgagagacgaacttagaata
attgacaattcaccgcaaagtgaagaatatgcgatgaaagttgaagacacaaacggtgta
tatgttgttcctgcttttgtaggacttggagcaccttattgggatatgtatgcaaggggt
acgattgtaggacttacaaggggagcaaaaagggaacatataataagggcaacactggaa
tccattgcttatcagacaagagatgtactagaggctatgcaagaggattcgggaatcaga
ttacaagctttaaaagttgacggtggagcaagtgctaataacttcttgatgcaattccaa
tctgacattttaggcgttccggttgacaggcctcaagtaattgaaactactgctttaggt
gcttcttatcttgcaggattggcagtaggattctggaacagcagagaagaaatagaaaag
aattggaatgttgataagcattttgaacctgctatggataatgaaaagagagaaaaattg
tataaaggttggaaaaaggctgtagaaagggctatgaaatgggctgaagaataa

DBGET integrated database retrieval system