KEGG   Thermoanaerobacter brockii: Thebr_0593Help
Entry
Thebr_0593        CDS       T01409                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo00010  Glycolysis / Gluconeogenesis
tbo00052  Galactose metabolism
tbo00500  Starch and sucrose metabolism
tbo00520  Amino sugar and nucleotide sugar metabolism
tbo00521  Streptomycin biosynthesis
tbo01100  Metabolic pathways
tbo01110  Biosynthesis of secondary metabolites
tbo01120  Microbial metabolism in diverse environments
tbo01130  Biosynthesis of antibiotics
tbo01200  Carbon metabolism
Module
tbo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thebr_0593
   00052 Galactose metabolism
    Thebr_0593
   00500 Starch and sucrose metabolism
    Thebr_0593
   00520 Amino sugar and nucleotide sugar metabolism
    Thebr_0593
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thebr_0593
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Thebr_0593
Enzymes [BR:tbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Thebr_0593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N Pan_kinase
Motif
Other DBs
NCBI-ProteinID: ADV79194
JGI: Thebr_0593
UniProt: E8UW39
Position
612571..613509
Genome map
AA seq 312 aa AA seqDB search
MRIGVDLGGTNIAVGLVDEEGRIVATGSRPTKPERGYEAVAKDIAEIALELINRTNTDIK
EIKSMGIGVPGVADSEKGIVIRAVNLFWTKVPLAKEIRKYIDLPIYMDNDANVAALAEAV
FGAGRGSKSSVTITLGTGVGSGFVLDGKIYNGAHHFAPEIGHIVIGNNGVRCNCGKVGCL
ETYASATALIREGKKAAKKDPNSLILKFANGDIENITAKNVIDAAKQYDEEAIKIFNDYV
KYLAIGIVNVINMLDPEVIILGGGVANAGDFLIKPLKKEVAENILFKDLPYADIRKAELG
NDAGIIGAAILG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggtgttgaccttggaggcactaatattgctgttggattggtagatgaggaa
ggacgtatagtagcaacaggcagtagacccacaaaaccagaaagaggttatgaagcggtt
gccaaggatatagcagaaatagctcttgagcttattaatagaactaatactgatataaaa
gagattaaatcaatgggtattggagttccaggagtagcagacagtgaaaagggtatagtg
atacgggcagttaatcttttttggacaaaagtacctcttgcaaaagaaataagaaaatat
attgatttgccaatatatatggacaatgatgcaaatgtagcggctttggcagaggcggta
tttggtgctggcagaggttcaaaatcatctgtgacaattactttaggcacaggagtaggg
tctggatttgttctagatggcaaaatatataacggtgctcaccattttgcacctgagatt
gggcacatagtaataggtaacaatggcgtaaggtgtaattgtggtaaagttggttgtttg
gaaacatacgcttcagctactgctttaataagagaagggaaaaaggccgctaaaaaagac
cctaactctcttattttaaaatttgcaaatggggatatagaaaatataacggctaaaaat
gtaattgatgccgcaaagcagtatgatgaagaggctatcaagatttttaatgactatgtc
aaatatttagctattggaattgtaaatgtcataaacatgcttgatcctgaagtgataata
ttaggcggcggtgtcgcaaatgcgggggattttcttataaagcctctcaaaaaagaagtg
gcggagaatattttgtttaaagaccttccttatgctgacatacgaaaagcagagcttgga
aatgatgcgggaatcatcggtgctgctatactaggttaa

DBGET integrated database retrieval system