KEGG   Thermoanaerobacter brockii: Thebr_0629Help
Entry
Thebr_0629        CDS       T01409                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
tbo  Thermoanaerobacter brockii
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Thebr_0629
  Lipid metabolism
   00600 Sphingolipid metabolism
    Thebr_0629
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Thebr_0629
Enzymes [BR:tbo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Thebr_0629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
649526..651757
Genome map
AA seq 743 aa AA seqDB search
MGRDVLNFNVDWLYIPEDLNDAYKFDFDESNFEVVSLPHANKTFPHHYFKEEDYRFVSWY
RKHFKVDERYKGKKVYIHFEGVITVAKVYVNGEFVGEHKGGYTPFEFDITEYIKYGNFEN
LIAVQVDSREHKDIPPEGHLVDYMLFGGIYRNVWLKILNDTHIKDVYFVVDKLQDSVAEI
SITTTIAGKEISNGKILTEVINKEGVVCSSVVTDIKEMQKEIVQQIKMDNPLTWHPDHPY
LYNVSVKLIAENEILDNYTFKTGIRTVEFRDDGKFYINGEPLKLRGLNRHQTFPYVGGAM
PDRVQRKDADILKYELGLNYVRTSHYPQAVSFLDRCDEIGLLVFEEIPGWQHIGDENWKN
IAKENLKEMILRDRNHPCIFMWGVRINESLDDHDFYKEMNEIAHKLDRSRPTGGVRYLRD
SEKLEDVFTYNDFIYNLEGKIQLPNHKKYMVTEYMGHMYPTKSYDNLNRLITHARLHALI
QDKQYGIPNMAGASGWCAFDYNTTSAFGSGDNICYHGVCDIFRLPKFAAHFYRSQADPHL
YGPYVFIASYLIPSFEEENGDKLLVFSNCEEVELYINDKFVKRQMPNRVDFPSLPHPPFE
FSMKECGINYMEVRVNNASITAIGLIDGKEVARHTLRPYGKPHKLILSCDDNEIMADGAD
CTRVVVSVVDENGSILPYANIPVSFEIEGEGKLIGENPLTLEAGRGAVYVKSTRKPGEII
LKAKSHYVAEESNVSIKTKSIGY
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgggtagagatgtattgaattttaatgtagattggctatatattcctgaagacttaaat
gatgcatataaatttgattttgatgagagcaattttgaagttgttagtcttcctcatgca
aacaaaacatttcctcaccactattttaaagaagaagactacaggtttgtttcatggtac
agaaaacattttaaagtagatgagagatacaaagggaaaaaggtttatattcattttgaa
ggtgttataactgttgcgaaggtttatgtaaatggcgaatttgtaggagaacataaagga
ggatatactccttttgaatttgatattacagagtatattaaatacggtaattttgaaaat
ttaattgctgtacaagtggattcaagagagcataaagatattcctccagaaggtcatctt
gtagattacatgttgtttggtggaatatacagaaatgtatggctgaaaattttaaatgat
acccatataaaagatgtttattttgttgttgataaattgcaagattctgttgctgaaatt
tcaattactacaactattgcaggaaaagaaataagcaatggaaagatattgacagaggtt
ataaataaagaaggcgttgtgtgttcatcagtggttactgacataaaagagatgcaaaaa
gagattgtacagcaaataaagatggacaatccattaacttggcatccagatcatccgtat
ttatataatgtgtctgtaaaacttattgcagagaatgaaattttagataattatactttt
aagacaggaataaggacagttgaatttagagatgacggcaaattttatattaatggtgaa
cctttaaaattgagaggattaaacagacatcagacttttccttatgttggcggtgctatg
ccggatagggttcaaagaaaagatgcagatatactaaagtatgaattgggattaaattat
gttaggacgtcacattatccgcaggctgtttcatttttggatagatgtgatgagataggt
ttgttagtttttgaagagatacctggatggcagcatataggcgatgaaaattggaagaac
attgcaaaagagaatttaaaagaaatgattttaagagatagaaatcatccttgtatattt
atgtggggtgtgcgaataaatgagtctttagatgaccacgatttttataaagaaatgaat
gaaatagctcataaattagacagaagtagaccaacaggtggtgttagatatttaagagat
agtgaaaagctagaggatgtatttacatataacgactttatatacaatttagaaggcaaa
atacaacttccaaatcacaaaaagtatatggtaacagaatatatgggtcacatgtatccg
acaaaatcttatgataaccttaatcgacttattactcatgcaaggttgcatgctcttatt
caagacaaacaatatgggataccaaacatggctggtgcatcaggctggtgtgcatttgat
tataataccacaagtgcttttggttcaggagacaatatatgctatcatggagtctgtgat
atatttagacttccaaagtttgcagctcatttttacaggagtcaagccgacccgcactta
tatggaccctatgtgtttatagcttcgtacttaataccatcatttgaggaagagaacggc
gataaattgcttgtatttagcaattgcgaagaagtagaactttatataaatgataaattt
gtgaaaagacaaatgcccaatagagttgattttcctagtttaccacatccgccttttgaa
ttttcaatgaaggaatgcggaatcaactatatggaggtaagagttaataacgcttctatt
actgcgataggtttgatagacggtaaggaagtagcaagacatacattaaggccatatggg
aaaccacataaattaattctttcttgtgatgataatgagattatggcagatggcgctgat
tgtacaagggttgttgtaagtgttgtagatgaaaatggatctattcttccttatgctaat
ataccagtatcatttgaaatagaaggtgaaggaaagctgattggggaaaatccgttgaca
ttagaggctggcagaggagcagtttatgtaaaatcgacacgaaagccgggagaaataatt
ttaaaagctaaatctcattatgtagcggaagaaagcaatgtatctataaaaactaagtca
ataggatattaa

DBGET integrated database retrieval system