KEGG   Thermoanaerobacter brockii: Thebr_0701Help
Entry
Thebr_0701        CDS       T01409                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tbo  Thermoanaerobacter brockii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thebr_0701
   01230 Biosynthesis of amino acids
    Thebr_0701
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thebr_0701
   00030 Pentose phosphate pathway
    Thebr_0701
   00051 Fructose and mannose metabolism
    Thebr_0701
   00052 Galactose metabolism
    Thebr_0701
  Energy metabolism
   00680 Methane metabolism
    Thebr_0701
Enzymes [BR:tbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Thebr_0701
Protein phosphatases and associated proteins [BR:tbo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Thebr_0701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
726891..727856
Genome map
AA seq 321 aa AA seqDB search
MKTIGILTSGGDAPGMNAAIRAVVRTGIYYGLKVKGIMRGYAGLVEDEVIDLNLSSVGDI
LQKGGTILRTARCEEFKKKEVRKKAYETLQKHGIEGLVVIGGDGSFRGAQLLSEEWNVNT
IGIPGTIDNDIPCTDYTIGFDTACNTVIDAINKIRDTATSHERANIIEVMGRNAGYIALY
AGLAGGAEMIILPEVEWSIDELCDKITYGIKRGKLHHIIVLAEGVMSAPELAKMIKERLP
KLDLRYTILGHIQRGGAPTVMDRVLASQMGARAVELLLENKTKRIISIRNNQIVDDDIDE
ALSMKKEFNRKLYELSKILSI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaattggtatacttacgagtggtggagatgcaccagggatgaacgcagctata
agggctgtggtgaggacaggaatttattatgggcttaaagtaaaaggtattatgagggga
tatgcaggcttagtagaggatgaagttattgacttaaatctttcttcagtaggagatata
ttgcaaaaaggcggtactattttgagaactgctagatgtgaagaatttaagaaaaaagag
gtgcgcaaaaaagcttacgaaacccttcaaaaacatggaatagaaggtctcgttgtaatt
ggaggagatggctcttttagaggagcacagcttttgagtgaagaatggaatgtaaataca
attggaattccaggtacaattgacaatgacataccttgtacagattatacaataggtttt
gatacagcttgtaatactgttattgatgcaataaataaaataagggatactgctacttcc
catgagagagcaaatataatagaagtgatgggaagaaatgcgggttacattgctttgtat
gctggtctagctggtggagcggagatgattatacttcctgaagtggaatggagcatcgat
gaactttgcgataaaattacttacgggataaagagaggaaagcttcatcatataattgtc
cttgcagaaggagttatgagcgctccagaactagcgaaaatgattaaagaaaggctacca
aaattggacttaaggtatactattttggggcacattcaaagaggtggagctcctacagtg
atggatagggtattggcaagccaaatgggagcaagagcagtggagttgcttttagaaaat
aaaaccaagaggataataagtatacgaaacaatcaaattgtagacgatgatatagatgaa
gccctttccatgaaaaaggagtttaacagaaaactttatgagctcagcaagatattgtct
atataa

DBGET integrated database retrieval system