KEGG   Thermoanaerobacter brockii: Thebr_0701Help
Entry
Thebr_0701        CDS       T01409                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo00010  Glycolysis / Gluconeogenesis
tbo00030  Pentose phosphate pathway
tbo00051  Fructose and mannose metabolism
tbo00052  Galactose metabolism
tbo00680  Methane metabolism
tbo01100  Metabolic pathways
tbo01110  Biosynthesis of secondary metabolites
tbo01120  Microbial metabolism in diverse environments
tbo01130  Biosynthesis of antibiotics
tbo01200  Carbon metabolism
tbo01230  Biosynthesis of amino acids
tbo03018  RNA degradation
Module
tbo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thebr_0701
   00030 Pentose phosphate pathway
    Thebr_0701
   00051 Fructose and mannose metabolism
    Thebr_0701
   00052 Galactose metabolism
    Thebr_0701
  Energy metabolism
   00680 Methane metabolism
    Thebr_0701
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Thebr_0701
Enzymes [BR:tbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Thebr_0701
Protein phosphatases and associated proteins [BR:tbo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Thebr_0701
Messenger RNA biogenesis [BR:tbo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Thebr_0701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADV79295
JGI: Thebr_0701
UniProt: E8UWL3
Position
726891..727856
Genome map
AA seq 321 aa AA seqDB search
MKTIGILTSGGDAPGMNAAIRAVVRTGIYYGLKVKGIMRGYAGLVEDEVIDLNLSSVGDI
LQKGGTILRTARCEEFKKKEVRKKAYETLQKHGIEGLVVIGGDGSFRGAQLLSEEWNVNT
IGIPGTIDNDIPCTDYTIGFDTACNTVIDAINKIRDTATSHERANIIEVMGRNAGYIALY
AGLAGGAEMIILPEVEWSIDELCDKITYGIKRGKLHHIIVLAEGVMSAPELAKMIKERLP
KLDLRYTILGHIQRGGAPTVMDRVLASQMGARAVELLLENKTKRIISIRNNQIVDDDIDE
ALSMKKEFNRKLYELSKILSI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaattggtatacttacgagtggtggagatgcaccagggatgaacgcagctata
agggctgtggtgaggacaggaatttattatgggcttaaagtaaaaggtattatgagggga
tatgcaggcttagtagaggatgaagttattgacttaaatctttcttcagtaggagatata
ttgcaaaaaggcggtactattttgagaactgctagatgtgaagaatttaagaaaaaagag
gtgcgcaaaaaagcttacgaaacccttcaaaaacatggaatagaaggtctcgttgtaatt
ggaggagatggctcttttagaggagcacagcttttgagtgaagaatggaatgtaaataca
attggaattccaggtacaattgacaatgacataccttgtacagattatacaataggtttt
gatacagcttgtaatactgttattgatgcaataaataaaataagggatactgctacttcc
catgagagagcaaatataatagaagtgatgggaagaaatgcgggttacattgctttgtat
gctggtctagctggtggagcggagatgattatacttcctgaagtggaatggagcatcgat
gaactttgcgataaaattacttacgggataaagagaggaaagcttcatcatataattgtc
cttgcagaaggagttatgagcgctccagaactagcgaaaatgattaaagaaaggctacca
aaattggacttaaggtatactattttggggcacattcaaagaggtggagctcctacagtg
atggatagggtattggcaagccaaatgggagcaagagcagtggagttgcttttagaaaat
aaaaccaagaggataataagtatacgaaacaatcaaattgtagacgatgatatagatgaa
gccctttccatgaaaaaggagtttaacagaaaactttatgagctcagcaagatattgtct
atataa

DBGET integrated database retrieval system