KEGG   Thermoanaerobacter brockii: Thebr_0755Help
Entry
Thebr_0755        CDS       T01409                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo00010  Glycolysis / Gluconeogenesis
tbo00051  Fructose and mannose metabolism
tbo01100  Metabolic pathways
tbo01110  Biosynthesis of secondary metabolites
tbo01120  Microbial metabolism in diverse environments
tbo01130  Biosynthesis of antibiotics
tbo01200  Carbon metabolism
tbo01230  Biosynthesis of amino acids
Module
tbo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tbo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thebr_0755
   00051 Fructose and mannose metabolism
    Thebr_0755
   00562 Inositol phosphate metabolism
    Thebr_0755
Enzymes [BR:tbo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Thebr_0755
Exosome [BR:tbo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Thebr_0755
  Exosomal proteins of bladder cancer cells
   Thebr_0755
  Exosomal proteins of melanoma cells
   Thebr_0755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADV79346
JGI: Thebr_0755
UniProt: E8UQM3
Position
777420..778190
Genome map
AA seq 256 aa AA seqDB search
MISKGVFVLRRPIIAGNWKMHMTPSEAVKLVEELIPQVKDAKAEVVVIPPFVDLTEVNKV
IQGTNILLGAQDMFWEEKGAYTGEISPLMLKEIGVKYVVIGHSERRQYFGETDEMVNKKV
LSALSHGLSPIVCVGESLSQREEGKTFEVVLNQTKEALKGVSHDDIVNVVIAYEPIWAIG
TGKTATAKDANEVIKALRNTIASLYGKEKASLVRIQYGGSVKPENISELMAESDIDGALV
GGASLVASDFAKIVNY
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgataagtaaaggggtgtttgttttgagaagaccaataattgcaggtaactggaaaatg
cacatgaccccttctgaagcggtgaagttagttgaggaattgatacctcaagtgaaagac
gcaaaagcagaagttgtagtaatacctccttttgttgacttgacagaggtaaataaagta
attcaaggtactaatattcttctcggagcacaagatatgttttgggaagaaaagggcgca
tatacgggggaaatttcacctttaatgcttaaagagattggggtgaaatatgttgtaata
ggccactctgaaagaaggcagtattttggtgagactgatgaaatggtgaataaaaaagtt
ttatccgctctatctcacggcttaagtcctattgtgtgtgtaggagaatctctttctcaa
agagaagaaggaaaaacttttgaagtagttttaaatcaaactaaagaggctttaaaaggt
gtttcccacgatgatattgtaaatgtagtaatagcttatgagccaatttgggctataggt
actggcaaaactgctacagctaaagatgccaatgaagtgataaaagctttaaggaatact
atagcttccctttatggaaaagaaaaagcaagtttagttaggatacagtatggggggagt
gtaaagcccgagaacatttctgaactcatggcagagagcgatatagacggggctttagta
gggggagcaagtcttgtagcatcagattttgcaaagattgtcaattattaa

DBGET integrated database retrieval system