KEGG   Thermoanaerobacter brockii: Thebr_0772Help
Entry
Thebr_0772        CDS       T01409                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tbo  Thermoanaerobacter brockii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thebr_0772
  Amino acid metabolism
   00300 Lysine biosynthesis
    Thebr_0772
Enzymes [BR:tbo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Thebr_0772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
794466..795860
Genome map
AA seq 464 aa AA seqDB search
MDLNSYIDNMRDDIIKSVQELVRIKSVQDEPKPGMPYGEGIAKALDKALEIAQSLGLKTK
NVDGYVGYAEYGEGEEMIGVLGHLDVVPEGDGWTYPPYGAEIHDGKIYGRGTVDDKGPII
AALYGLKAIKDAGLELSRRVRILFGTNEETGSHEIPYYLKHDEAPTMGFTPDAQYPIIYA
EKGITMFNVVKDFNKKPSNIVIKYIKGGERPNVVPGFCEAGLKVKEANKKKEIQDKLEAF
VKETGYNLKAEEKDEMLVIKSVGVSAHGSLPHLGKNAIMQLFLFLDRIDLEDSDVKDFIH
FFATNIGIETNGKTFGIYLKDETGELTFNVGTIQLDESKGVLGLNIRYPVKYKYEDWMNI
FENKIKTNGMRIEDMLHQPPLYFPPAHPLIKTLSKVYEEQTGQKAELLAIGGGTYAKEMP
NTVAFGPVFPGKPELAHQADEYIEIEDLILNAKIYAHAIYELAK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggatttaaattcctacatagacaatatgagagatgacattataaaatcagttcaagag
ttggtcaggataaaaagcgtacaagatgaaccgaaaccaggaatgccttatggagaaggt
attgctaaggcattggacaaagctttagagattgcacaaagtttaggcttaaaaactaaa
aatgtggatggctatgtagggtatgcagaatacggcgaaggagaagaaatgataggagtt
ttgggacatttagatgtggttccagaaggtgatgggtggacttatccaccttatggtgct
gaaatccatgatggaaagatatatggaagaggtactgtagatgataagggaccgataatc
gctgctttatatggcttaaaagctataaaagatgcaggattagaactttccagaagagtg
aggattttatttggtacaaatgaagagactggttctcatgaaattccttattatttaaaa
cacgatgaagcgcctacaatgggctttactcctgatgctcaatatcccatcatatatgca
gaaaagggaataacaatgtttaatgtagtaaaagactttaataaaaagcccagcaatata
gttataaaatacatcaaaggtggagaaaggcctaatgtagtgccaggcttttgtgaagct
ggattaaaggtaaaagaggcaaataagaagaaagaaattcaagataagctagaagctttc
gtaaaagagacgggttacaatttgaaggctgaagaaaaagacgaaatgcttgtaatcaaa
tcagtaggggtttcggctcatggcagccttccacacttagggaaaaatgctataatgcag
ctatttctcttccttgacagaatcgatttagaagatagcgatgtcaaagattttatacat
ttcttcgctacaaatattggaatagaaacaaacggaaaaacttttggaatatacttaaaa
gatgaaacaggagaattgacttttaacgttggtactattcaattagatgaaagcaaagga
gtattaggtttaaatatcaggtatcctgtaaaatataaatatgaggattggatgaatatt
tttgagaataaaatcaaaactaatggaatgagaatagaagacatgctccatcagccacct
ttgtatttcccaccagcccatcctttgataaaaactttgagcaaggtttatgaagaacag
acaggacagaaggcagagcttttagcaataggtggaggaacttacgcgaaagagatgcct
aacacagtggcttttgggcctgttttcccaggcaagccagagttagcacatcaagcggat
gaatatatagaaattgaagatttgatattaaatgcaaaaatttatgctcacgctatatat
gaattagcaaaataa

DBGET integrated database retrieval system