KEGG   Thermoanaerobacter brockii: Thebr_0918Help
Entry
Thebr_0918        CDS       T01409                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo00260  Glycine, serine and threonine metabolism
tbo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tbo01100  Metabolic pathways
tbo01110  Biosynthesis of secondary metabolites
tbo01130  Biosynthesis of antibiotics
tbo01230  Biosynthesis of amino acids
Module
tbo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thebr_0918
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thebr_0918
Enzymes [BR:tbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thebr_0918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADV79499
JGI: Thebr_0918
UniProt: E8URH6
Position
937454..938629
Genome map
AA seq 391 aa AA seqDB search
MSGRFGRFGGQYVPETVMNALIELEREFEKAKEDKDFMEEYRYYLREYSGRPTPLYYAEN
LTKRLGGAKIYLKREDLNHTGAHKINNVLGQILLAKRMNKKRVIAETGAGQHGVATATAA
AMFGMECEIFMGEEDIKRQSLNVFRMKLLGAKVTPVTTGTKTLKDAVNEAIRDWVTNIDN
TFYVIGSVVGPHPYPTMVRDFQRVIGDEAKEQILQKEGRLPDYVIACVGGGSNAMGIFYP
FIEDKEVKLIGVEAAGEGIETGKHAAAMAKGSVGVLHGMMTYLLQDEEGRIMPVYSISAG
LDYPGVGPEHAFLKESNRAQYVYATDEEALAAFMDLSQTEGIIPALESAHALAYAMKLAP
NLTKDNIIIVNLSGRGDKDVNTVAKVLGVEL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaagatttggacgttttggaggtcagtatgtgccagagactgtgatgaatgcg
cttatagaattagagagggaatttgaaaaagctaaagaagataaagatttcatggaagaa
tacaggtactatttgagggaatattcaggaaggcctacacctttgtattatgcagagaat
cttactaaaaggcttggtggggcaaaaatttatctaaagagggaagacctaaaccacaca
ggagctcataagataaacaacgtattgggacagattttgttagcaaaacggatgaataaa
aagagagttatagcagaaacaggagctgggcagcatggagttgcaacggctaccgctgct
gcgatgtttgggatggaatgcgaaatattcatgggagaagaagatataaaaaggcaatct
ttaaacgtctttagaatgaaacttttaggtgcaaaagtgacgccagtaactacagggaca
aaaacccttaaagatgcggtaaatgaagcaataagagattgggtgacaaatatagataat
actttttatgtgataggttctgttgttggtcctcatccttatcctacaatggtgagagat
tttcaaagagtgataggggatgaagcaaaagaacaaatacttcaaaaagaaggaagactt
cctgattatgtgattgcttgtgttggtggaggcagcaatgcaatgggaattttctatccc
ttcattgaagataaagaggtaaaattgataggagtagaagcagccggagaagggattgag
acagggaaacatgcagctgcaatggcgaaaggctctgtaggagtattgcacggcatgatg
acttatcttttacaggatgaagaggggagaataatgccagtatactctatatctgcagga
ctggattacccaggtgtaggtccagaacatgcctttttaaaagaaagtaatagagctcaa
tatgtatatgcgacagacgaagaagcattggcggcttttatggatttatctcaaacagaa
gggataataccagctttggaaagtgctcacgctttggcatatgctatgaaactggctcca
aatttaacgaaagacaatattatcattgtaaatttgtcaggcagaggagataaagacgta
aatacagttgcaaaagtattgggggtggagttatga

DBGET integrated database retrieval system