KEGG   Thermoanaerobacter brockii: Thebr_0919Help
Entry
Thebr_0919        CDS       T01409                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tbo  Thermoanaerobacter brockii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thebr_0919
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thebr_0919
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thebr_0919
Enzymes [BR:tbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thebr_0919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
938626..939414
Genome map
AA seq 262 aa AA seqDB search
MNRIDKKFEVLKGEGRKALITFITAGDPDIETTYDIVLAIEEVGADIIELGIPYSDPLAD
GPTIQASSQRALNKGVKIPDIMRIVEKIRFKSDIPLVYLVYYNSIFKYGIQKFLKESKDV
GIDGLIIPDLPLEERKDILEEADKYGIYLIPLVAPTSKERIKLITENGKGFVYCVSITGV
TGAREDIETDIEEYMKTVSQYTNMPKAIGFGISTPEMAKKLKDFSDGIIVGSALVERIAK
GYNKSEMLQEVKSFVSILKEVL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaataggattgacaaaaagtttgaagttttaaaaggagaagggcgcaaagccttaata
acctttataacagcgggagacccggatattgagacaacttatgatatagttttggctata
gaagaagtaggagcggatataatagaacttggaataccttattctgatcccttagctgat
ggacctacaatacaggcatcttctcaaagagctttaaataaaggtgtaaaaattcctgat
ataatgagaatagtagaaaaaataaggtttaaaagcgatatcccgctggtttaccttgta
tactataactctatattcaaatatggtatacaaaagtttttaaaagagtcaaaagatgta
gggatagatggacttatcattccagatttgcctcttgaagaaagaaaggatattttagaa
gaagcagataaatacggtatttatttaatacctttagtcgctcccacatcaaaagaaaga
ataaaattaatcactgaaaatggcaaaggatttgtatattgcgtatcaattacaggtgtc
acaggagcaagagaagacattgaaactgacattgaagaatatatgaagacagtctctcaa
tataccaatatgccaaaggcaatagggtttggcatatctactccggagatggcgaaaaaa
ttaaaagattttagtgatgggattattgtagggagtgcccttgtagaaagaattgctaaa
gggtataataaatctgaaatgctgcaggaagttaagagttttgtatccatcttaaaagaa
gtgttatga

DBGET integrated database retrieval system