KEGG   Thermoanaerobacter brockii: Thebr_1039Help
Entry
Thebr_1039        CDS       T01409                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tbo  Thermoanaerobacter brockii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Thebr_1039
Enzymes [BR:tbo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Thebr_1039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1069401..1069964
Genome map
AA seq 187 aa AA seqDB search
MIEYVRGIIEDIGQDYVVIDFMGIGIKVFVPFSTLKVLPSKGNITKLYTYLQVREDGFQI
FGFKTKEELDLFEKLLSVSGVGPKGALSILSVVSIDNFVKAVNAGDYKALTVAPGIGKKT
AERIILELKDKLPKEIVFEGDNNFSNEALEALLALGYTKSEAIYALADITCDSVEDAVKQ
ALKKLMK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgattgagtatgttagagggataattgaagatattggacaagattacgtagtgattgac
tttatgggtataggtataaaggtttttgttcccttttctactttaaaagttttaccttct
aaaggaaatataaccaagctttatacatatttacaggtgagagaagatggttttcaaatt
tttggctttaaaacaaaagaagagctagatttgtttgaaaaattattgtctgttagtggt
gtagggccgaaaggagctttgtctattttgtccgtggtttctattgacaattttgtaaaa
gcagttaacgcaggcgattataaagctcttacagtagctccgggaataggcaaaaagact
gctgagagaattattttggaattaaaagataagcttccaaaagaaatagtttttgaaggt
gataataatttttcaaatgaggctttagaagctttattagcgttgggttacaccaagagt
gaagctatttatgctttggcagatatcacctgtgatagcgtagaagatgctgtaaagcaa
gctttgaaaaaattaatgaaatag

DBGET integrated database retrieval system