KEGG   Thermoanaerobacter brockii: Thebr_1458Help
Entry
Thebr_1458        CDS       T01409                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tbo  Thermoanaerobacter brockii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tbo00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1453530..1455041)
Genome map
AA seq 503 aa AA seqDB search
MCGLAGIIGTGDKSKVQRMLDKIRHRGPDESGIFADENITLGHNRLTIIDLYHGRQPIKN
EDGRYWLIYNGEIYNYQLLRKELKNHIFSTDTDSEVIIHLYEELGKNCVNYIDGMFALVI
YDSKKKTIFIARDPLGIKPLYYGKTKEGYFAFASEIKALQEVTDDINEFPNGYIYTTENG
FERYYSIPQDPMHFADVDNIINGLRLRLEDSVRKRLIADVPVGVFLSGGLDSSLIAAIAA
KYKNPLHSFAVGVEGSNDLKNARVVADYVGTIHHEFIYTEEDIKKVLPKVIYHLESCDPA
LVRSAVATYFVSKLASNYVKVILSGEGADELFSGYHYLKNYTNPWKLQSELKYITRNLHN
TNLQRVDRMTMAHSIEGRVPFLDIEVLRYAFKITPSFKINGREKTEKWILRKLAENYLPE
SIVWRRKEKFAIGTGTSEILNKIAESEISDAEYIKNRFLPNGFEIKSKEELYYFKILKRF
FNVDSFIKDMGRSRSLNDNQIYA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggattggcaggaattataggaactggtgataagagcaaagtacaaaggatgctt
gataaaatacgacatcgtggcccggatgagtcaggtatttttgcagatgaaaatattaca
ttaggccataataggttgacgataattgacctttatcatggacgccaacctataaaaaac
gaagatggcaggtattggcttatttataatggagaaatttacaattaccaattattgcgt
aaagagttaaaaaaccatattttttccacagatactgatagcgaagtaataattcatttg
tatgaagaactaggtaaaaattgtgttaactatattgatggaatgtttgctttagttatt
tatgactctaaaaaaaagaccatatttattgctcgcgatccgttaggaataaagccattg
tattatggtaaaacaaaagaaggttattttgcctttgcttcggagattaaagcacttcag
gaagtaactgatgatataaatgaatttcctaatggatatatttatacaactgaaaacgga
tttgagagatattattcaattccacaggatccgatgcattttgcagatgttgataatatt
attaatggattaaggcttagattagaggattcagtaagaaaaaggttgattgctgatgtg
cctgttggagtatttttaagtggcggattggatagcagccttatagcagcaatagcagca
aaatacaaaaatccccttcactcatttgcagtaggtgtcgaaggaagtaatgacttaaag
aatgcaagagttgttgctgattatgtaggtacgattcaccatgaatttatttatacagag
gaggacataaaaaaagttttacccaaagttatatatcatcttgaatcctgtgatccagcc
ttagtcagaagtgctgttgcaacatattttgtatcaaaacttgcaagcaattacgtaaag
gttattctttcgggagaaggtgctgatgagttatttagtggataccattacctcaaaaat
tatacaaatccttggaaattacaatctgaattaaaatatataactcgaaatttgcataat
acaaatcttcaaagagttgacagaatgacaatggcacattccattgagggacgtgtaccg
tttttagatatagaagtgttacggtacgcatttaaaataacaccgtcatttaaaattaac
ggccgagaaaaaaccgaaaagtggatacttagaaagcttgcagaaaattatttaccagaa
tcaattgtatggagaagaaaagaaaaatttgcaataggaactggtacatctgaaatatta
aataaaatagccgaatcagaaattagtgatgcagagtatataaaaaatagattcctacct
aacggttttgaaataaagtctaaagaagagttgtattattttaaaattttaaaaagattt
tttaatgttgattcttttataaaggacatgggaagaagtagaagcctcaatgacaaccaa
atatatgcataa

DBGET integrated database retrieval system