KEGG   Thermoanaerobacter brockii: Thebr_1592Help
Entry
Thebr_1592        CDS       T01409                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tbo  Thermoanaerobacter brockii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Thebr_1592
   00052 Galactose metabolism
    Thebr_1592
   00500 Starch and sucrose metabolism
    Thebr_1592
   00520 Amino sugar and nucleotide sugar metabolism
    Thebr_1592
Enzymes [BR:tbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Thebr_1592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1580061..1580969)
Genome map
AA seq 302 aa AA seqDB search
MKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAIQSGIEDILIITGRNK
RAIEDHFDKSVELELELKKKNKESLLNLVEDISNMVNIHYIRQKEPKGLGHAIYCAKSFV
GNEPFAVLLGDDIVDSEVPVLKQMIDQYERYNCSIIGVQEVPYEDVDKYGIVDAAIIEDR
LYKVKDLVEKPKKEKAPSNIAILGRYIITPRIFEILENTPPGAGGEIQLTDALKTLLNYE
AIYAYNFIGKRYDVGDKLGYLMATVEYALKREDLSEPFKRYLLELVDNLTAIEKEAAVTK
VK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaataagaaaggcgataattccggctgcaggccttggtacgaggtttttgcctgct
accaaggctcagcctaaagaaatgcttccaattgtggacaaacccactattcaatatata
gtcgaagaggcgattcaatcgggaattgaggatatccttataataactggcagaaataaa
agagcaatagaagaccattttgataaatctgtggagttggagctggagttaaaaaagaaa
aacaaggaaagtttacttaaccttgtagaggatattagcaatatggtgaacattcactat
ataaggcaaaaggaacctaaagggttgggacatgctatttactgtgctaaatcttttgta
ggaaatgagccttttgcagtacttttaggagatgacatagtagattcagaagtgccggtt
ttaaagcagatgattgaccaatacgaaaggtacaactgttctattattggggtacaagag
gtgccgtatgaggatgtagataaatatggaatagttgacgctgctattattgaggataga
ttatacaaagtcaaagaccttgtggaaaagcctaaaaaagaaaaggcgccttctaacatc
gctattttgggaagatatataattacaccaagaatatttgaaatattggaaaacacgcca
ccaggagcaggaggtgaaatacagcttacagatgctttaaaaactctcttaaattatgaa
gcaatttacgcctataattttattggcaagagatatgatgtgggagataaattaggttac
cttatggcaactgttgagtatgctctaaaaagagaggacttaagtgaaccttttaagagg
tatttattagaacttgttgacaatttaacagctatcgaaaaggaggctgcggttacaaaa
gtaaaatag

DBGET integrated database retrieval system