KEGG   Thermoanaerobacter brockii: Thebr_1834Help
Entry
Thebr_1834        CDS       T01409                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
tbo  Thermoanaerobacter brockii
Pathway
tbo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:tbo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Thebr_1834
Enzymes [BR:tbo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Thebr_1834
DNA repair and recombination proteins [BR:tbo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Thebr_1834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 HHH_5 Viral_helicase1 AAA_11 PIF1 Helicase_RecD DUF2075 PhoH ArgK UvrD_C AAA_24 DEAD T2SSE AAA_22 DNA_pol_lambd_f SRP54 ABC_tran AAA_12 AAA_28 Ribosomal_S13 RsgA_GTPase NTPase_1 AAA_16 HHH ATPase_2 HHH_2 TrwB_AAD_bind AAA cobW UvrD-helicase KAP_NTPase AAA_29 DUF853 MobB Zeta_toxin CbiA Thymidylate_kin MMR_HSR1 AAA_23
Motif
Other DBs
NCBI-ProteinID: ADV80369
JGI: Thebr_1834
UniProt: E8UWB8
Position
complement(1821689..1823896)
Genome map
AA seq 735 aa AA seqDB search
MIDIEGVVEEIIFRNEQNGYTVLELSTQGLVVTAVGYMPYVNIGERIKIEGEWVEHPDYG
EQIRVLNYETLAPTTLEGIEKFLSSGLIPGIGPVTARKIVKKFGVDSLNIIETAPERLKE
IKGLSDEKIKRICEAYEMQKGIKEVMVFLQGYGISTAMAIKIYKEYGNNAIEIIKQNPYR
LADDIFGIGFKTADKIAESLGVDPHSLYRISSGTRYVLMQYAANGHTYVPKELLKKEAAS
LLEVSEEEVEDSFVLLVQNEKIHIETFEDDTVGIYYIPYYIAELHTAERLFNMTLMENED
LGIDVQKEIKNFEKETGILLAENQKLAVEEAVKNSVVVITGGPGTGKTTIINCIIRIFEK
AGKKVALAAPTGRAAKRITEATGKEAKTIHRLLEYTYSEEEGKGFNKNEKDPLKYDVIIV
DEASMVDILLMNALLKALPIGAKLILVGDADQLPSVGAGNVLRDIIDSGIVKVIRLKEIF
RQQKQSLIVVNAHKINNGEYPTYNDKNSDFFFINANTQEDILKTILELVTNRLPKAYGFH
PINDIQVLTPMRKGIIGVHNLNLELQKALNPHDKTKAEKIMKEFVFRVGDKVMQIKNNYK
IKWKKGDEEGEGVFNGDIGIIQSIDEELQELTVYFDDEKFVTYDFSDLNELNLSYAITVH
KSQGSEFPVVIMPITYGPPMLLTRNLLYTAVTRAKKLVILVGQEKYLKFMIDNNRISKRY
SGLLSRLKKALLYVN
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgattgacatagagggtgtagttgaagaaataatttttagaaatgaacaaaatggttat
acggttttagaattaagtacccaaggtttagtagtcactgctgtaggttatatgccttat
gtaaacattggggaaagaattaaaattgaaggagaatgggtagaacatcctgattatggt
gagcaaattagggttttaaattatgaaaccttggctcccaccactttagaaggaatagaa
aagtttttatcttctggcttaattcctggaataggtcctgttacagcaagaaaaattgta
aaaaagtttggcgttgattctttaaatataattgaaactgcaccagaaagattaaaagaa
ataaaaggtctaagcgatgagaagataaaaagaatttgtgaagcttatgaaatgcaaaag
ggcataaaagaagtgatggtgtttttgcaggggtacggtatttccactgcaatggctata
aagatttataaagaatacggaaacaacgcgattgaaattattaagcaaaacccttacaga
ttggctgacgatatatttggaataggatttaaaactgcagacaaaatagcagagagccta
ggagttgaccctcattctctatatcgcatatcttctggtactcgatatgttttgatgcag
tatgcggcaaatggtcacacctatgtgccgaaagaattgttaaaaaaagaagcagcaagt
ttgttagaagtgagcgaagaagaagtagaggattcttttgtgcttttagtacaaaatgaa
aaaatacatattgaaacttttgaagatgatactgtaggaatttactatataccttactat
atagctgaattacacacagcagagagattgtttaacatgacactaatggaaaatgaagat
ttaggcatagatgtccaaaaagaaattaaaaattttgaaaaagaaacaggtattttgtta
gcagaaaatcaaaaattggctgttgaagaagctgttaaaaattctgttgttgtcataacg
ggaggaccaggcacaggaaagactacaataataaattgtataatacgtatttttgaaaaa
gctggtaaaaaagtggctcttgcagccccaacaggaagagccgcaaaaaggataacggaa
gctactggaaaagaggcgaagactattcataggcttttagaatatacttattcggaggaa
gaagggaagggctttaacaaaaatgaaaaagatccattaaaatacgacgttataatagtt
gacgaagcttcaatggtagatatattgcttatgaatgctttattaaaagccctacctata
ggggcaaaactgattttagtaggggatgctgatcagcttccatctgttggagccggaaat
gtcctaagagatataatagacagtggaatagtaaaagtgatacgtttaaaagaaattttt
agacagcaaaagcaaagtttgatagtagtaaatgctcacaagataaataatggagaatat
ccaacctataacgataaaaatagtgatttcttttttataaatgctaacacccaagaggat
atattaaaaaccatattggagcttgtgacaaacagacttcctaaagcttatggatttcat
cctattaatgatattcaagtactcacccctatgagaaaagggataattggtgttcacaat
ttaaatttagagctgcaaaaagcattaaatccccacgacaaaactaaagccgaaaaaata
atgaaggagtttgtcttcagggtgggggataaagtgatgcaaataaaaaataactacaag
ataaaatggaaaaaaggcgatgaagaaggagaaggagtgtttaacggagatataggaata
attcaatcaatagacgaagaattacaggaattgactgtatattttgacgacgaaaaattt
gtcacttatgacttttctgacttgaatgaactaaatttgtcttatgctataacagtacac
aaaagccaaggcagtgaatttcctgttgtcataatgccaattacttatggaccccctatg
ctattaacaagaaaccttttgtacactgccgttacaagggcgaagaaattggttattttg
gtaggtcaagagaaatatttgaaatttatgattgacaacaatagaatctcaaaaagatat
tcagggcttctttcaaggcttaaaaaagcacttttgtatgtaaactaa

DBGET integrated database retrieval system